MYBPC3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

MYBPC3 Protein, positioned in the crossbridge region of vertebrate striated muscle A bands, binds to myosin heavy chain (MHC), F-actin, and native thin filaments, influencing actin-activated myosin ATPase. Its presence suggests potential modulation of muscle contraction, indicating a functional impact on the contractile apparatus, or a structural role in muscle fibers. MYBPC3 Protein, Human (HEK293, His) is the recombinant human-derived MYBPC3 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MYBPC3 Protein, positioned in the crossbridge region of vertebrate striated muscle A bands, binds to myosin heavy chain (MHC), F-actin, and native thin filaments, influencing actin-activated myosin ATPase. Its presence suggests potential modulation of muscle contraction, indicating a functional impact on the contractile apparatus, or a structural role in muscle fibers. MYBPC3 Protein, Human (HEK293, His) is the recombinant human-derived MYBPC3 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

MYBPC3 Protein is a thick filament-associated protein situated in the crossbridge region of vertebrate striated muscle A bands. In vitro, it exhibits binding affinity for myosin heavy chain (MHC), F-actin, and native thin filaments, thereby influencing the activity of actin-activated myosin ATPase. Its role extends to potential modulation of muscle contraction, suggesting a functional impact on the contractile apparatus, or it may serve a structural role in the muscle fibers.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • MYBPC3 (M1-A328)
      Accession # Q14896-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MYBPC3; Mutant Cardiac Myosin-Binding Protein C; Prev. CMH4; Myosin-Binding Protein C Cardiac; Myosin-Binding Protein C, Cardiac-Type; Myosin-Binding Protein C; CMyBP-C; Cardiac MyBP-C; FHC; CMD1MM; Myosin Binding Protein C, Cardiac; LVNC10; C-Protein, Ca

  • AA Sequence

    MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEAETERAGVKVRWQRGGSDISASNKYGLATEGTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVIEAEKAEPMLAPAPAPAEATGAPGEAPAPAAELGESAPSPKGSSSAALNGPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAGASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQA

  • Predicted Molecular Mass

    34.8 kDa

  • Molecular Weight

    Approximately 36 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00