MYL12A Protein, Human (His)
MYL12A Protein, Human (His) is the recombinant human-derived MYL12A protein, expressed by E. coli, with C-6*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MYL12A Protein, Human (His) is the recombinant human-derived MYL12A protein, expressed by E. coli, with C-6*His tag.
Background
MYL12A is a myosin regulatory subunit that plays a crucial role in regulating contractile activity in both smooth muscle and nonmuscle cells through its phosphorylation. It is also implicated in cytokinesis, receptor capping, and cell locomotion (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P19105 (M1-D171)
-
Gene ID10627
-
Molecular Construction
-
N-term
-
P19105 MYL12A (M1-D171)
Accession # -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
MYL12A; Myosin Regulatory Light Chain MRLC3; Myosin Light Chain 12A; Epididymis Secretory Protein Li 24; MRLC3; Myosin Regulatory Light Chain 12A; MRCL3; Myosin Regulatory Light Chain 3; MLCB; Myosin RLC; MYL2B; HEL-S-24; Myosin, Light Polypeptide, Regula
-
AA Sequence
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
-
Predicted Molecular Mass
26.7 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
