Neurogranin Protein, Human (His)
Neurogranin Protein, Human (His) is the recombinant human-derived Neurogranin protein, expressed by E. coli, with N-His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Neurogranin Protein, Human (His) is the recombinant human-derived Neurogranin protein, expressed by E. coli, with N-His tag.
Background
Neurogranin acts as a 'third messenger' substrate in protein kinase C-mediated molecular cascades during synaptic development and remodeling. It binds to calmodulin in the absence of calcium (By similarity).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q92686 (M1-D78)
-
Gene ID4900
-
Molecular Construction
-
N-term
-
His
-
Neurogranin (M1-D78)
Accession # Q92686 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NRGN; Calmodulin-Binding Protein; Neurogranin; Protein Kinase C Substrate; RC3; Hng; Neurogranin (Protein Kinase C Substrate, RC3); Ng
-
AA Sequence
MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD
-
Predicted Molecular Mass
9.5 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
