NKG2C/CD159c Protein, Mouse (HEK293, hFc)
The NKG2C/CD159c protein is an immune-activating receptor that critically differentiates self from non-self by forming a complex with KLRD1. It recognizes non-canonical MHC-E loaded with signal sequence-derived peptides from MHC-G molecules and contributes to the generation and effector function of adaptive NK cells, playing a role in maternal-fetal tolerance. NKG2C/CD159c Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived NKG2C/CD159c protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NKG2C/CD159c protein is an immune-activating receptor that critically differentiates self from non-self by forming a complex with KLRD1. It recognizes non-canonical MHC-E loaded with signal sequence-derived peptides from MHC-G molecules and contributes to the generation and effector function of adaptive NK cells, playing a role in maternal-fetal tolerance. NKG2C/CD159c Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived NKG2C/CD159c protein, expressed by HEK293 , with C-hFc labeled tag.
Background
NKG2C/CD159c protein operates as an immune activating receptor crucial for self-nonself discrimination. When forming a complex with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility complex MHC-E loaded with signal sequence-derived peptides from non-classical MHC-G molecules. This recognition likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and plays a role in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infections. Upon MHC-E-peptide binding, it transmits intracellular signals via the adapter protein TYROBP/DAP12, leading to the phosphorylation of proximal signaling molecules and cell activation. NKG2C/CD159c forms a heterodimer with KLRD1, and this complex, disulfide-linked, interacts with TYROBP/DAP12 homodimer, an interaction crucial for the expression of NKG2C/CD159c on the cell surface. This intricate mechanism underscores the significant role of NKG2C/CD159c in immune responses, particularly in recognizing and responding to specific MHC-E-peptide complexes and modulating the functions of cytotoxic lymphocytes.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9MZK6 (I94-L231)
-
Gene ID709790
-
Molecular Construction
-
N-term
-
NKG2C (I94-L231)
Accession # Q9MZK6 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
KLRC2; NK Cell Receptor C; Killer Cell Lectin Like Receptor C2; NKG2-C; NKG2-C Type II Integral Membrane Protein; CD159c; NKG2C; Killer Cell Lectin-Like Receptor Subfamily C, Member 2; CD159 Antigen-Like Family Member C; Natural Killer Cell Receptor G2-C;
-
AA Sequence
IPFLEQNNSFPNTRTQKVRHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTSKNSSLLSIDNEEEMKFLTAISPSTWTGVFRDSSHHPWVTINGLTFKHEIKDSDHAEYNCAMLHLDRLKSVQCGSSKRYYCKHKL
-
Predicted Molecular Mass
42.8 kDa
-
Molecular Weight
Approximately 52-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)