1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins
  4. NKG2C/CD159c
  5. NKG2C/CD159c Protein, Mouse (HEK293, hFc)

The NKG2C/CD159c protein is an immune-activating receptor that critically differentiates self from non-self by forming a complex with KLRD1. It recognizes non-canonical MHC-E loaded with signal sequence-derived peptides from MHC-G molecules and contributes to the generation and effector function of adaptive NK cells, playing a role in maternal-fetal tolerance. NKG2C/CD159c Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived NKG2C/CD159c protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NKG2C/CD159c protein is an immune-activating receptor that critically differentiates self from non-self by forming a complex with KLRD1. It recognizes non-canonical MHC-E loaded with signal sequence-derived peptides from MHC-G molecules and contributes to the generation and effector function of adaptive NK cells, playing a role in maternal-fetal tolerance. NKG2C/CD159c Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived NKG2C/CD159c protein, expressed by HEK293 , with C-hFc labeled tag.

Background

NKG2C/CD159c protein operates as an immune activating receptor crucial for self-nonself discrimination. When forming a complex with KLRD1 on cytotoxic lymphocyte subsets, it recognizes non-classical major histocompatibility complex MHC-E loaded with signal sequence-derived peptides from non-classical MHC-G molecules. This recognition likely contributes to the generation and effector functions of adaptive natural killer (NK) cells and plays a role in maternal-fetal tolerance during pregnancy. NKG2C/CD159c also regulates the effector functions of terminally differentiated cytotoxic lymphocyte subsets, particularly in the adaptive NK cell response to viral infections. Upon MHC-E-peptide binding, it transmits intracellular signals via the adapter protein TYROBP/DAP12, leading to the phosphorylation of proximal signaling molecules and cell activation. NKG2C/CD159c forms a heterodimer with KLRD1, and this complex, disulfide-linked, interacts with TYROBP/DAP12 homodimer, an interaction crucial for the expression of NKG2C/CD159c on the cell surface. This intricate mechanism underscores the significant role of NKG2C/CD159c in immune responses, particularly in recognizing and responding to specific MHC-E-peptide complexes and modulating the functions of cytotoxic lymphocytes.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9MZK6 (I94-L231)

Gene ID

709790

Molecular Construction
N-term
NKG2C (I94-L231)
Accession # Q9MZK6
hFc
C-term
Protein Length

Extracellular Domain

Synonyms
CD159c; KLRC2; NKG2C; NK cell receptor C
AA Sequence

IPFLEQNNSFPNTRTQKVRHCGHCPEEWITYSNSCYYIGKEKRTWAESLLACTSKNSSLLSIDNEEEMKFLTAISPSTWTGVFRDSSHHPWVTINGLTFKHEIKDSDHAEYNCAMLHLDRLKSVQCGSSKRYYCKHKL

Predicted Molecular Mass
42.8 kDa
Molecular Weight

Approximately 52-60 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

NKG2C/CD159c Protein, Mouse (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NKG2C/CD159c Protein, Mouse (HEK293, hFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NKG2C/CD159c Protein, Mouse (HEK293, hFc)
Cat. No.:
HY-P700801
Quantity:
MCE Japan Authorized Agent: