NLRP3 Protein, Mouse (His-SUMO)
Based on 1 publication(s) in Google Scholar
The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
NLRP3 protein functions as the sensor component of the NLRP3 inflammasome, orchestrating inflammasome activation in response to defects in membrane integrity. Upon encountering pathogens or damage-associated signals affecting membrane integrity, NLRP3 initiates the assembly of the inflammasome polymeric complex composed of NLRP3, CASP1, and PYCARD/ASC. Recruitment of pro-caspase-1 to the NLRP3 inflammasome results in caspase-1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to cytokine secretion and pyroptosis. NLRP3 activation stimuli encompass a range of factors, including extracellular ATP, nigericin, reactive oxygen species, crystals, and various environmental particles. Notably, almost all stimuli induce intracellular K(+) efflux, contributing to membrane perturbation and NLRP3 activation. The activated NLRP3 is transported to the microtubule organizing center (MTOC) and, upon interaction with NEK7, undergoes relocalization to dispersed trans-Golgi network (dTGN) vesicle membranes, forming an active inflammasome complex. Additionally, NLRP3 plays a role in T helper 2 (Th2) cell differentiation, influencing Th2 cell-dependent processes such as asthma and tumor growth by regulating the transcription of key genes involved in these pathways.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Med Chem
Scaffold Hybrid of the Natural Product Tanshinone I with Piperidine for the Discovery of a Potent NLRP3 Inflammasome Inhibitor. [Abstract]2023 Feb 23;66(4):2946-2963. PMID: 36786612
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q8R4B8-1 (M1-R153)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
NLRP3 (M1-R153)
Accession # Q8R4B8-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NLRP3; AII; Prev. CIAS1; Cold-Induced Autoinflammatory Syndrome 1 Protein; Prev. C1orf7; PYRIN-Containing APAF1-Like Protein 1; Prev. DFNA34; Deafness, Autosomal Dominant 34; CLR1.1; Caterpiller Protein 1.1; PYPAF1; NACHT Domain-, Leucine-Rich Repeat-, An
-
AA Sequence
MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)