NLRP3 Protein, Mouse (His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NLRP3 protein acts as a sensor in the NLRP3 inflammasome, which is activated in response to membrane defects caused by pathogens or damage signals. It assembles the inflammasome complex, including NLRP3, CASP1, and PYCARD/ASC. NLRP3 Protein, Mouse (His-SUMO) is the recombinant mouse-derived NLRP3 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

NLRP3 protein functions as the sensor component of the NLRP3 inflammasome, orchestrating inflammasome activation in response to defects in membrane integrity. Upon encountering pathogens or damage-associated signals affecting membrane integrity, NLRP3 initiates the assembly of the inflammasome polymeric complex composed of NLRP3, CASP1, and PYCARD/ASC. Recruitment of pro-caspase-1 to the NLRP3 inflammasome results in caspase-1 activation, subsequently cleaving and activating inflammatory cytokines IL1B and IL18, along with gasdermin-D (GSDMD), leading to cytokine secretion and pyroptosis. NLRP3 activation stimuli encompass a range of factors, including extracellular ATP, nigericin, reactive oxygen species, crystals, and various environmental particles. Notably, almost all stimuli induce intracellular K(+) efflux, contributing to membrane perturbation and NLRP3 activation. The activated NLRP3 is transported to the microtubule organizing center (MTOC) and, upon interaction with NEK7, undergoes relocalization to dispersed trans-Golgi network (dTGN) vesicle membranes, forming an active inflammasome complex. Additionally, NLRP3 plays a role in T helper 2 (Th2) cell differentiation, influencing Th2 cell-dependent processes such as asthma and tumor growth by regulating the transcription of key genes involved in these pathways.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • NLRP3 (M1-R153)
      Accession # Q8R4B8-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NLRP3; AII; Prev. CIAS1; Cold-Induced Autoinflammatory Syndrome 1 Protein; Prev. C1orf7; PYRIN-Containing APAF1-Like Protein 1; Prev. DFNA34; Deafness, Autosomal Dominant 34; CLR1.1; Caterpiller Protein 1.1; PYPAF1; NACHT Domain-, Leucine-Rich Repeat-, An

  • AA Sequence

    MTSVRCKLAQYLEDLEDVDLKKFKMHLEDYPPEKGCIPVPRGQMEKADHLDLATLMIDFNGEEKAWAMAVWIFAAINRRDLWEKAKKDQPEWNDTCTSHSSMVCQEDSLEEEWMGLLGYLSRISICKKKKDYCKMYRRHVRSRFYSIKDRNAR

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00