Nmes1 Protein, Mouse (His-SUMO)
Nmes1 protein is prominently expressed in diverse tissues such as vertebrae, brain, intestine, and stomach. Nmes1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nmes1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Nmes1 protein is prominently expressed in diverse tissues such as vertebrae, brain, intestine, and stomach. Nmes1 Protein, Mouse (His-SUMO) is the recombinant mouse-derived Nmes1 protein, expressed by E. coli , with N-His, N-SUMO labeled tag.
Background
Nmes1 protein exhibits robust expression in various tissues, including vertebrae, brain, intestine, and stomach.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-His;N-SUMO
-
Accession
Q810Q5 (M1-R83)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
Nmes1 (M1-R83)
Accession # Q810Q5 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
COXFA4L3; Normal Mucosa Of Esophagus-Specific Gene 1 Protein; Prev. C15orf48; Mitochondrial Stress Response Antiviral; NMES1; Normal Mucosa Of Esophagus Specific 1; MOCCI; Chromosome 15 Open Reading Frame 48; MIR147BHG; MIR147B Host Gene; MISTRAV; Protein
-
AA Sequence
MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
-
Predicted Molecular Mass
25.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
