NODAL Protein, Human
Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. NODAL Protein, Human is the recombinant human-derived NODAL protein, expressed by E. coli, with tag free.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Nodal protein plays a key role in embryonic development and is indispensable for mesoderm formation and axial patterning. As a homodimer linked together by disulfide bonds, Nodal helps form the molecular framework that controls fundamental developmental pathways, ensuring the correct establishment of mesodermal tissue and axial structure during embryogenesis. NODAL Protein, Human is the recombinant human-derived NODAL protein, expressed by E. coli, with tag free.
Nodal protein plays a pivotal role in embryonic development, serving as an indispensable factor for both mesoderm formation and axial patterning. As a homodimer held together by disulfide linkages, Nodal contributes to the molecular framework that governs essential developmental pathways, ensuring the proper establishment of mesodermal tissues and axial structures during embryogenesis. This protein, free from animal-derived components, underscores its suitability for applications demanding stringent purity and ethical considerations in research and biotechnological endeavors.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q96S42 (H238-L347)
-
Gene ID4838
-
Molecular Construction
-
N-term
-
NODAL (H238-L347)
Accession # Q96S42 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
NODAL; Nodal, Mouse, Homolog; Nodal Growth Differentiation Factor; Nodal Homolog (Mouse); Nodal Homolog; HTX5
-
AA Sequence
HHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL
-
Predicted Molecular Mass
12.9 kDa
-
Molecular Weight
Approximately 14-15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (259 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
