1. Recombinant Proteins
  2. Enzymes & Regulators Ubiquitin Related Proteins
  3. Transferases (EC 2) Ubiquitin Enzymes
  4. E3 Ligases
  5. NOSIP Protein, Human (His)

NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human (His) is the recombinant human-derived NOSIP protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

NOSIP is an E3 ubiquitin protein ligase that plays a key role in the normal development of the forebrain, eye, and face. Notably, it catalyzes the monoubiquitination of the serine/threonine protein phosphatase 2A (PP2A) catalytic subunit, specifically PPP2CA/PPP2CB. NOSIP Protein, Human (His) is the recombinant human-derived NOSIP protein, expressed by E. coli , with N-6*His labeled tag.

Background

NOSIP is a crucial E3 ubiquitin-protein ligase essential for proper development of the forebrain, eye, and face. It plays a pivotal role in cellular processes by catalyzing the monoubiquitination of the serine/threonine-protein phosphatase 2A (PP2A) catalytic subunit PPP2CA/PPP2CB. Moreover, NOSIP serves as a negative regulator of nitric oxide production by inducing the translocation of NOS1 and NOS3 to the actin cytoskeleton, ultimately inhibiting their enzymatic activity. This dual functionality highlights the significance of NOSIP in both developmental processes and the regulation of nitric oxide signaling, underscoring its versatile role in cellular homeostasis.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y314 (T2-A301)

Gene ID

51070

Molecular Construction
N-term
6*His
NOSIP (T2-A301)
Accession # Q9Y314
C-term
Protein Length

Partial

Synonyms
NOSIP; Nitric oxide synthase-interacting protein; E3 ubiquitin-protein ligase NOSIP; RING-type E3 ubiquitin transferase NOSIP; eNOS-interacting protein
AA Sequence

TRHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQDHVRGFLEKESAIVSRPLNPFTAKALSGTSPDDVQPGPSVGPPSKDKDKVLPSFWIPSLTPEAKATKLEKPSRTVTCPMSGKPLRMSDLTPVHFTPLDSSVDRVGLITRSERYVCAVTRDSLSNATPCAVLRPSGAVVTLECVEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQA

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NOSIP Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NOSIP Protein, Human (His)
Cat. No.:
HY-P701598
Quantity:
MCE Japan Authorized Agent: