TrkC Protein, Human (Active, Biotinylated, sf9, His, Avi)
TrkC Protein, a receptor tyrosine kinase, crucially contributes to nervous system and potential heart development. Upon NTF3/neurotrophin-3 binding, TrkC undergoes autophosphorylation, activating pathways like phosphatidylinositol 3-kinase/AKT and MAPK. These pathways regulate cell survival and differentiation, emphasizing TrkC's pivotal role in essential cellular processes during development. TrkC Protein, Human (Biotinylated, sf9, His, Avi) is the recombinant human-derived NTRK3, expressed by Sf9 insect cells, with Avi, His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
TrkC Protein, a receptor tyrosine kinase, crucially contributes to nervous system and potential heart development. Upon NTF3/neurotrophin-3 binding, TrkC undergoes autophosphorylation, activating pathways like phosphatidylinositol 3-kinase/AKT and MAPK. These pathways regulate cell survival and differentiation, emphasizing TrkC's pivotal role in essential cellular processes during development. TrkC Protein, Human (Biotinylated, sf9, His, Avi) is the recombinant human-derived NTRK3, expressed by Sf9 insect cells, with Avi, His labeled tag.
Background
TrkC Protein, a receptor tyrosine kinase, plays a crucial role in nervous system and potential heart development. Upon binding to its ligand NTF3/neurotrophin-3, TrkC undergoes autophosphorylation, initiating various signaling pathways such as the phosphatidylinositol 3-kinase/AKT and the MAPK pathways. These pathways are instrumental in regulating cell survival and differentiation, highlighting the pivotal role of TrkC in orchestrating essential cellular processes during development.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-Avi;N-His
-
Accession
Q16288-3 (Y456-G825)
-
Gene ID4916
-
Protein Length
Partial
-
Conjugation
Biotin
-
Synonyms
NTRK3; Neurotrophin 3 Receptor Truncated Isoform; Neurotrophic Receptor Tyrosine Kinase 3; Tyrosine-Protein Kinase Receptor; TRKC; Receptor Protein-Tyrosine Kinase; Neurotrophic Tyrosine Kinase, Receptor, Type 3; Tyrosine Kinase Receptor C; NT-3 Growth Fa
-
AA Sequence
YGRRSKFGMKGPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
