NUDT5 Protein, Human (His)
Based on 1 Customer Validation
The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The NUDT5 protein acts as an ADP-glycopyrophosphatase or synthesizes ATP. NUDT5 Protein, Human (His) is the recombinant human-derived NUDT5 protein, expressed by E. coli , with N-His labeled tag.
Background
NUDT5, a versatile enzyme, exhibits dual functionality by acting as an ADP-sugar pyrophosphatase in the absence of diphosphate and catalyzing ATP synthesis in the presence of diphosphate. In the absence of diphosphate, NUDT5 demonstrates hydrolytic activity towards various modified nucleoside diphosphates, including ADP-ribose, ADP-mannose, ADP-glucose, 8-oxo-GDP, and 8-oxo-dGDP. Additionally, it can hydrolyze other nucleotide sugars with low activity. When dephosphorylated at Thr-45, NUDT5 facilitates ATP synthesis in the nucleus by converting ADP-ribose to ATP and ribose 5-phosphate. This nuclear ATP generation is crucial for energy-consuming chromatin remodeling events. Despite its diverse enzymatic activities, NUDT5 does not play a role in U8 snoRNA decapping activity, although it exhibits binding affinity for U8 snoRNA.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9UKK9 (M1-F219)
-
Molecular Construction
-
N-term
-
His
-
NUDT5 (E2-F219)
Accession # Q9UKK9 -
C-term
-
-
Protein Length
Full length
-
Synonyms
NUDT5; Nucleoside Diphosphate-Linked Moiety X Motif 5; Nudix Hydrolase 5; HYSAH1; YSA1H; HNUDT5; Nuclear ATP-Synthesis Protein NUDIX5; Nudix Motif 5; ADP-Sugar Pyrophosphatase; NUDIX5; 8-Oxo-DGDP Phosphatase; YSAH1; Nudix (Nucleoside Diphosphate Linked Mo
-
AA Sequence
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTADGVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)