NUP50 Protein, Human (His, Strep)
NUP50 Protein, Human (His, Strep) is the recombinant human-derived NUP50, expressed by E. coli , with Strep, His labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NUP50 Protein, Human (His, Strep) is the recombinant human-derived NUP50, expressed by E. coli , with Strep, His labeled tag. ,
Background
NUP50 is a component of the nuclear pore complex that plays a direct role in nuclear protein import. It actively displaces nuclear localization signals (NLSs) from importin-alpha and facilitates the disassembly of the importin-alpha:beta-cargo complex, promoting importin recycling. Additionally, NUP50 interacts with cell cycle regulatory proteins, including CDKN1B (by similar), and this interaction is required for proper intracellular transport and degradation of CDKN1B (by similar).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Strep;His
-
Accession
Q9UKX7-1 (E351-A468)
-
Gene ID10762
-
Protein Length
Partial
-
Synonyms
NUP50; Nucleoporin Nup50; Prev. NPAP60L; Nuclear Pore-Associated Protein 60L; Nuclear Pore Complex Protein Nup50; Nucleoporin 50kD; 50 KDa Nucleoporin; NPAP60; Nucleoporin 50kDa; Nucleoporin 50; Nuclear Pore-Associated Protein 60 KDa-Like
-
AA Sequence
EVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA
-
Predicted Molecular Mass
16.5 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
