NXPH1 Protein, Rat (HEK293, His)

The NXPH1 protein is similar to a neuropeptide and acts as a signaling molecule by binding to alpha-neurotoxins.Its ligand action is suggested to mediate cell signaling through interactions with neuronal cell adhesion proteins.NXPH1 Protein, Rat (HEK293, His) is the recombinant rat-derived NXPH1 protein, expressed by HEK293 , with C-His labeled tag.

The NXPH1 protein appears to function as a signaling molecule with characteristics reminiscent of neuropeptides. It is identified as a ligand for alpha-neurexins, suggesting a role in mediating cellular signaling through interactions with these neuronal cell adhesion proteins. The potential implication of NXPH1 as a signaling entity underscores its significance in neural communication and hints at its involvement in modulating cellular processes through interactions with alpha-neurexins. Further exploration of the specific mechanisms and downstream effects of NXPH1's interactions with alpha-neurexins could provide valuable insights into its role within the broader context of neurobiology.

Measured in a competitive binding assay. When Neurexin-1 alpha is immobilized at 1 µg/mL (100 µL/well), Neurexophilin-1 inhibits binding of biotinylated Neurexophilin-1 (1 µg/mL). The IC₅₀ for this effect is 0.1095 μg/mL.

• 
  Measured in a competitive binding assay. When Neurexin-1 alpha is immobilized at 1 µg/mL (100 µL/well), Neurexophilin-1 inhibits binding of biotinylated Neurexophilin-1 (1 µg/mL) .The IC₅₀ for this effect is 0.1095 μg/mL.

Rat

HEK293

C-6*His

Q63366 (A22-G271)

25501  [NCBI]

Full Length of Mature Protein

ANLTNGGKSELLKSGNSKSTLKHIWTESSKDLSISRLLSQTFRGKENGTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSG

Approximately 43-55 kDa due to the glycosylation

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.