OBCAM/OPCML Protein, Human (HEK293, His)

OBCAM/OPCML Protein uniquely binds opioids, especially in the presence of acidic lipids, indicating a potential role in cellular interactions and signaling related to opioid binding. This dual affinity suggests involvement in cell-contact processes where opioids and acidic lipids are present, highlighting its significance in modulating cellular responses to external stimuli and contributing to opioid-related signaling pathways. OBCAM/OPCML Protein, Human (HEK293, His) is the recombinant human-derived OBCAM/OPCML protein, expressed by HEK293 , with C-His labeled tag.

The OBCAM/OPCML Protein demonstrates a unique ability to bind opioids, particularly in the presence of acidic lipids, suggesting a potential role in cellular interactions and signaling related to opioid binding. This characteristic implies that OBCAM/OPCML may be involved in cell-contact processes where opioids and acidic lipids are present. The protein's dual affinity for opioids and acidic lipids underscores its potential significance in modulating cellular responses to external stimuli and highlights its potential contribution to opioid-related signaling pathways.

Measured by its binding ability in a functional ELISA. Immobilized Human OBCAM at 1 μg/mL (100 μL/well) can bind biotinylated human LSAMP. The ED₅₀ for this effect is 0.9464 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Human OBCAM at 1 μg/mL (100 μL/well) can bind biotinylated human LSAMP. The ED₅₀ for this effect is 0.9464 μg/mL.

Human

HEK293

C-His

Q14982-1/NP_002536.1 (G28-N322)

4978  [NCBI]

Full Length of OPCML

GVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVN

Approximately 45-60 kDa due to the glycosylation

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.