Copy Link Print Information

OBCAM/OPCML Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

OBCAM/OPCML Protein uniquely binds opioids, especially in the presence of acidic lipids, indicating a potential role in cellular interactions and signaling related to opioid binding. This dual affinity suggests involvement in cell-contact processes where opioids and acidic lipids are present, highlighting its significance in modulating cellular responses to external stimuli and contributing to opioid-related signaling pathways. OBCAM/OPCML Protein, Mouse (HEK293, His) is the recombinant mouse-derived OBCAM/OPCML protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for OBCAM/OPCML Protein, Mouse (HEK293, His)
  • Experimental Validation Results for OBCAM/OPCML Protein, Mouse (HEK293, His)
  • OBCAM/OPCML Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

OBCAM/OPCML Protein uniquely binds opioids, especially in the presence of acidic lipids, indicating a potential role in cellular interactions and signaling related to opioid binding. This dual affinity suggests involvement in cell-contact processes where opioids and acidic lipids are present, highlighting its significance in modulating cellular responses to external stimuli and contributing to opioid-related signaling pathways. OBCAM/OPCML Protein, Mouse (HEK293, His) is the recombinant mouse-derived OBCAM/OPCML protein, expressed by HEK293 , with C-His labeled tag.

Background

The OBCAM/OPCML Protein demonstrates a unique ability to bind opioids, particularly in the presence of acidic lipids, suggesting a potential role in cellular interactions and signaling related to opioid binding. This characteristic implies that OBCAM/OPCML may be involved in cell-contact processes where opioids and acidic lipids are present. The protein's dual affinity for opioids and acidic lipids underscores its potential significance in modulating cellular responses to external stimuli and highlights its potential contribution to opioid-related signaling pathways.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized mouse OBCAM at 0.5 μg/mL (100 μL/well) can bind biotinylated human LSAMP. The ED50 for this effect is 0.9972 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized mouse OBCAM at 0.5 μg/mL (100 μL/well) can bind biotinylated human LSAMP .The ED50 for this effect is 0.9972 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q6DFY2 (T30-V313)

  • Gene ID
    330908  [NCBI]
  • Molecular Construction
    • N-term
    • OPCML (T30-V313)
      Accession # Q6DFY2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    OPCML; CDNA, FLJ79172, Highly Similar To Opioid-Binding Protein/Cell Adhesion Moleculeprecursor; Opioid Binding Protein/Cell Adhesion Molecule Like; Opioid Binding Protein/Cell Adhesion Molecule-Like Preprotein Isoform A; IGLON1; Opioid Binding Protein/Ce

  • AA Sequence

    TFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGV

  • Molecular Weight

    Approximately 44-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized mouse OBCAM at 0.5 μg/mL (100 μL/well) can bind biotinylated human LSAMP .The ED50 for this effect is 0.9972 μg/mL.

  • OBCAM/OPCML Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for OBCAM/OPCML Protein, Mouse (HEK293, His)
  • Experimental Validation Results for OBCAM/OPCML Protein, Mouse (HEK293, His)
  • OBCAM/OPCML Protein, Mouse (HEK293, His) Product Image