omp1A Protein, other (His, SUMO)
omp1A Protein, other (His, SUMO) is the recombinant omp1A protein, expressed by E. coli, with N-SUMO & N-6*His tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
omp1A Protein, other (His, SUMO) is the recombinant omp1A protein, expressed by E. coli, with N-SUMO & N-6*His tag.
Background
omp1A provides structural integrity to the outer envelope of Chlamydia elementary bodies (EBs, the infectious stage that survives outside host cells) by forming disulfide cross-links with small cysteine-rich proteins and large cysteine-rich periplasmic proteins. It has been described as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex) in publications and serves as the functional equivalent of peptidoglycan (By similarity).
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
P23732 (L23-F396)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Synonyms
Major outer membrane porin, serovar A; MOMP; ompA; omp1A
-
AA Sequence
LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAAPTTRDVAGLEKDPVVNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQSSGFDTANIVPNTALNQAVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAKPVLDTTTLNPTIAGKGTVVSSAENELADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF
-
Predicted Molecular Mass
56.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
