1. Recombinant Proteins
  2. Others
  3. omp1A Protein, other (His, SUMO)

omp1A Protein, other (His, SUMO) is the recombinant omp1A protein, expressed by E. coli, with N-SUMO & N-6*His tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

omp1A Protein, other (His, SUMO) is the recombinant omp1A protein, expressed by E. coli, with N-SUMO & N-6*His tag.

Background

omp1A provides structural integrity to the outer envelope of Chlamydia elementary bodies (EBs, the infectious stage that survives outside host cells) by forming disulfide cross-links with small cysteine-rich proteins and large cysteine-rich periplasmic proteins. It has been described as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex) in publications and serves as the functional equivalent of peptidoglycan (By similarity).

Species

Others

Source

E. coli

Tag

N-SUMO;N-6*His

Accession

P23732 (L23-F396)

Gene ID

/

Protein Length

Full Length of Mature Protein

Synonyms
Major outer membrane porin, serovar A; MOMP; ompA; omp1A; SA1/OT / Serovar A
AA Sequence

LPVGNPAEPSLMIDGILWEGFGGDPCDPCTTWCDAISMRMGYYGDFVFDRVLKTDVNKEFQMGAAPTTRDVAGLEKDPVVNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTQSSGFDTANIVPNTALNQAVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAKPVLDTTTLNPTIAGKGTVVSSAENELADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Predicted Molecular Mass
56.6 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

omp1A Protein, other (His, SUMO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

omp1A Protein, other (His, SUMO)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
omp1A Protein, other (His, SUMO)
Cat. No.:
HY-P704053
Quantity:
MCE Japan Authorized Agent: