1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. OSM Protein, Mouse (HEK293, His)

OSM protein is a multifunctional growth regulator that effectively inhibits the proliferation of tumor cell lines and regulates the production of cytokines, including IL-6, G-CSF, and GM-CSF produced by endothelial cells.It specifically binds to type II OSM receptors, forming a heterodimer composed of OSMR and IL6ST.OSM Protein, Mouse (HEK293, His) is the recombinant mouse-derived OSM protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

OSM protein is a multifunctional growth regulator that effectively inhibits the proliferation of tumor cell lines and regulates the production of cytokines, including IL-6, G-CSF, and GM-CSF produced by endothelial cells.It specifically binds to type II OSM receptors, forming a heterodimer composed of OSMR and IL6ST.OSM Protein, Mouse (HEK293, His) is the recombinant mouse-derived OSM protein, expressed by HEK293 , with C-His labeled tag.

Background

OSM Protein emerges as a versatile growth regulator with a potent ability to inhibit the proliferation of various tumor cell lines. This multifaceted protein extends its influence to the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. OSM exclusively engages the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative effects, OSM is intricately involved in the maturation of fetal hepatocytes, playing a pivotal role in promoting both liver development and regeneration.

Biological Activity

Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.4530 ng/mL, corresponding to a specific activity is 2.206×106 U/mg.

  • Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.4530 ng/mL, corresponding to a specific activity is 2.206×106 U/mg.
Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

P53347 (N25-R206)

Gene ID
Molecular Construction
N-term
OSM (N25-R206)
Accession # P53347
8*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Oncostatin M; OSM; MGC20461; Oncostatin-M
AA Sequence

NRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR

Predicted Molecular Mass
21.6 kDa
Molecular Weight

Approximately 35-50 kDa, based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

OSM Protein, Mouse (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

OSM Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OSM Protein, Mouse (HEK293, His)
Cat. No.:
HY-P700805
Quantity:
MCE Japan Authorized Agent: