OSM Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
OSM protein is a multifunctional growth regulator that effectively inhibits the proliferation of tumor cell lines and regulates the production of cytokines, including IL-6, G-CSF, and GM-CSF produced by endothelial cells.It specifically binds to type II OSM receptors, forming a heterodimer composed of OSMR and IL6ST.OSM Protein, Mouse (HEK293, His) is the recombinant mouse-derived OSM protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
OSM protein is a multifunctional growth regulator that effectively inhibits the proliferation of tumor cell lines and regulates the production of cytokines, including IL-6, G-CSF, and GM-CSF produced by endothelial cells.It specifically binds to type II OSM receptors, forming a heterodimer composed of OSMR and IL6ST.OSM Protein, Mouse (HEK293, His) is the recombinant mouse-derived OSM protein, expressed by HEK293 , with C-His labeled tag.
OSM Protein emerges as a versatile growth regulator with a potent ability to inhibit the proliferation of various tumor cell lines. This multifaceted protein extends its influence to the regulation of cytokine production, including IL-6, G-CSF, and GM-CSF from endothelial cells. OSM exclusively engages the type II OSM receptor, forming heterodimers composed of OSMR and IL6ST. Beyond its antiproliferative effects, OSM is intricately involved in the maturation of fetal hepatocytes, playing a pivotal role in promoting both liver development and regeneration.
Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.4530 ng/mL, corresponding to a specific activity is 2.206×106 U/mg.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
P53347 (N25-R206)
-
Molecular Construction
-
N-term
-
OSM (N25-R206)
Accession # P53347 -
8*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
OSM; Oncostatin-M; Oncostatin M; MGC20461
-
AA Sequence
NRGCSNSSSQLLSQLQNQANLTGNTESLLEPYIRLQNLNTPDLRAACTQHSVAFPSEDTLRQLSKPHFLSTVYTTLDRVLYQLDALRQKFLKTPAFPKLDSARHNILGIRNNVFCMARLLNHSLEIPEPTQTDSGASRSTTTPDVFNTKIGSCGFLWGYHRFMGSVGRVFREWDDGSTRSRR
-
Predicted Molecular Mass
21.6 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
