Copy Link Print Information

Outer membrane porin F/OmpF Protein, E.coli (His, Myc)

Customer Review

Based on 1 Customer Validation

Outer membrane protein F (OmpF) facilitates the formation of pores, enabling the passive diffusion of small molecules across the bacterial outer membrane. Beyond its role in membrane permeability, OmpF serves as a crucial receptor for the bacteriophage T2 and is considered the primary receptor for colicin E5, playing a probable role in the mechanisms associated with these interactions. Outer membrane porin F/OmpF Protein, E.coli (His, Myc) is the recombinant E. coli-derived Outer membrane protein F/OmpF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Outer membrane porin F/OmpF Protein, E.coli (His, Myc)
  • Outer membrane porin F/OmpF Protein, E.coli (His, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Outer membrane protein F (OmpF) facilitates the formation of pores, enabling the passive diffusion of small molecules across the bacterial outer membrane. Beyond its role in membrane permeability, OmpF serves as a crucial receptor for the bacteriophage T2 and is considered the primary receptor for colicin E5, playing a probable role in the mechanisms associated with these interactions. Outer membrane porin F/OmpF Protein, E.coli (His, Myc) is the recombinant E. coli-derived Outer membrane protein F/OmpF protein, expressed by E. coli , with C-Myc, N-10*His labeled tag.

Background

The Outer membrane protein F (OmpF) plays a crucial role in bacterial physiology as it forms pores facilitating the passive diffusion of small molecules across the outer membrane. Serving as a key component in membrane permeability, OmpF contributes to the uptake of essential nutrients and substances by the bacterial cell. Furthermore, OmpF serves as a receptor for the bacteriophage T2, allowing the virus to recognize and infect the bacterial host. Additionally, there is a probable association between OmpF and colicin E5, where OmpF is identified as the major receptor for this bacteriocin. This dual functionality of OmpF in nutrient uptake and its interactions with bacteriophages and colicins underscores its significance in bacterial membrane dynamics and host-defense mechanisms.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession

    P02931 (A23-F362)

  • Gene ID
    945554  [NCBI]
  • Molecular Construction
    • N-term
    • 10*His
    • OmpF (A23-F362)
      Accession # P02931
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    Outer membrane porin F; Outer membrane protein 1A; Outer membrane protein B; Outer membrane protein F; Outer membrane protein IA; Porin OmpF; ompF; cmlB; coa; cry; tolF; JW0912; b0929

  • AA Sequence

    AEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDMTYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDYGRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYLGKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQPLGNGKKAEQWATGLKYDANNIYLAANYGETRNATPITNKFTNTSGFANKTQDVLLVAQYQFDFGLRPSIAYTKSKAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVYQF

  • Predicted Molecular Mass

    44.5 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1.0 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • Outer membrane porin F/OmpF Protein, E.coli (His, Myc) Product Image
    1/16
  • Experimental Validation Results for Outer membrane porin F/OmpF Protein, E.coli (His, Myc)
  • Outer membrane porin F/OmpF Protein, E.coli (His, Myc) Product Image