1. Recombinant Proteins
  2. Others
  3. Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

Cat. No.: HY-P71494
Handling Instructions Technical Support

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
20 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Outer membrane protein X/OmpX protein is an important member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. It plays a vital role in cellular processes and shares common structural and functional features among the OmpX family. Outer membrane protein X/OmpX Protein, E.coli (Myc, His) is the recombinant E. coli-derived Outer membrane protein X/OmpX protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

The Outer membrane protein X/OmpX Protein is an integral member of the outer membrane OOP (TC 1.B.6) superfamily, specifically belonging to the OmpX family. This protein plays a crucial role in cellular processes, and its affiliation with the OmpX family suggests shared structural and functional characteristics within this superfamily. As a member of the outer membrane OOP superfamily, OmpX is likely involved in membrane-related functions, possibly contributing to the stability and integrity of the outer membrane. The study of Outer membrane protein X/OmpX provides insights into the broader understanding of the outer membrane OOP superfamily, shedding light on potential roles and interactions that impact cellular dynamics and membrane integrity. Further exploration of the specific functions and features of OmpX can contribute to a comprehensive understanding of its significance within the context of membrane biology.

Species

E.coli

Source

E. coli

Tag

N-His;C-Myc

Accession

P0A919 (A24-F171)

Gene ID

917632  [NCBI]

Molecular Construction
N-term
10*His
OmpX (A24-F171)
Accession # P0A919
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
ompX; Z1036; ECs0892; Outer membrane protein X
AA Sequence

ATSTVTGGYAQSDAQGQMNKMGGFNLKYRYEEDNSPLGVIGSFTYTEKSRTASSGDYNKNQYYGITAGPAYRINDWASIYGVVGVGYGKFQTTEYPTYKHDTSDYGFSYGAGLQFNPMENVALDFSYEQSRIRSVDVGTWIAGVGYRF

분자량

Approximately 27 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Outer membrane protein X/OmpX Protein, E.coli (Myc, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Outer membrane protein X/OmpX Protein, E.coli (Myc, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Outer membrane protein X/OmpX Protein, E.coli (Myc, His)
Cat. No.:
HY-P71494
수량:
MCE Japan Authorized Agent: