OXYR Protein, Human (sf9, Flag, His)
OXYR Protein, Human (sf9, Flag, His) is the recombinant human-derived OXYR, expressed by sf9 insect cells , with His, Flag labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
OXYR Protein, Human (sf9, Flag, His) is the recombinant human-derived OXYR, expressed by sf9 insect cells , with His, Flag labeled tag. ,
Background
The Oxytocin Receptor is a receptor for oxytocin, whose activity is mediated by G proteins that activate a phosphatidylinositol-calcium second messenger system.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag His;Flag
-
Accession
P30559 (M1-L231, I266-E359, A19T, R65H, V120L, D153A, A167V, Q193R, S224A, S322C, N325K, T333M)
-
Gene ID5021
-
Protein Length
Partial
-
Synonyms
OXTR; OT-R; Oxytocin Receptor; Oxytocin Receptor Isoform A; OTR; Alternative Protein OXTR
-
AA Sequence
ISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWDANAPKEASAFIIVMLLASLNCCCKPWIYMLFMGHLFHELVQRFLCCSASYLKGRRLGE
-
Predicted Molecular Mass
61.7 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
