P2ER3 Protein, Human (His)
P2ER3 Protein, Human (His) is the recombinant human-derived P2ER3, expressed by E.coli , with His abeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
P2ER3 Protein, Human (His) is the recombinant human-derived P2ER3, expressed by E.coli , with His abeled tag.
P2ER3 is a receptor for prostaglandin E2 (PGE2), coupling to both the inhibition of adenylate cyclase via G(i) proteins and the elevation of intracellular calcium. It is essential for fever development in response to pyrogens such as IL1B, PGE2, and bacterial lipopolysaccharide (LPS). Additionally, P2ER3 potentiates PGE2-induced platelet aggregation, contributing to blood coagulation regulation. In the duodenum, it mediates increased HCO3(-) secretion upon mucosal acidification, protecting against acid-induced ulceration. By similarity, P2ER3 is not required for normal kidney function, urine volume, or osmolality.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
P43115 (M1-A53)
-
Gene ID5733
-
Molecular Construction
-
N-term
-
PTGER3 (M1-A53)
Accession # P43115 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PTGER3; Prostaglandin Receptor (PGE-2); Prostaglandin E Receptor 3; PGE Receptor, EP3 Subtype; Prostaglandin E2 Receptor EP3 Subtype; PGE Receptor EP3 Subtype; Prostanoid EP3 Receptor; EP3-III; Lnc003875; EP3-II; EP3; EP3-IV; Prostaglandin E Receptor 3 (S
-
AA Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
-
Predicted Molecular Mass
12.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O . For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
