P371 Protein, Human (L573F, sf9, FLAG)

The P371 protein is critical in cellular processes and mediates vitamin K-dependent carboxylation of glutamate residues to form calcium-binding γ-carboxyglutamic acid (Gla) residues. At the same time, it converts the reduced hydroquinone form of vitamin K into vitamin K epoxide. P371 Protein, Human (L573F, sf9, FLAG) is the recombinant human-derived P371 protein, expressed by sf9 insect cells , with C-Flag labeled tag.

P371 Protein plays a crucial role in cellular processes by mediating the vitamin K-dependent carboxylation of glutamate residues, converting them into calcium-binding gamma-carboxyglutamate (Gla) residues while simultaneously transforming the reduced hydroquinone form of vitamin K into vitamin K epoxide. The protein's catalytic activity extends to the gamma-carboxylation of diverse proteins, including blood coagulation factors (F2, F7, F9, and F10), osteocalcin (BGLAP), and matrix Gla protein (MGP). This enzymatic function is pivotal for the post-translational modification of these proteins, ensuring their proper biological activity, particularly in blood coagulation and bone metabolism. P371's role as a mediator in vitamin K-dependent processes highlights its significance in maintaining the functionality of various proteins critical to physiological homeostasis.

Human

Sf9 insect cells

C-Flag

P38435 (M1-F758, L573F)

2677

Full Length

MAVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTDPASLAVFRFLFGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNAHRRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSPFKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGLFFVSYFHCMNSQLFSIGMFSYVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRGKSGQKPGLRHQLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTFREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF

Approximately 80-85 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

1.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 10 mM DTT, 10 mM CaCl₂, 0.005% GDN.
2.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 8.0, 150 mM NaCl, 10 mM DTT, 10 mM CaCl₂, 0.005% (w/v) GDN.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

Please use rapid thawing with running water to thaw the protein.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.