Copy Link Print Information

P371 Protein, Human (L573F, sf9, FLAG)

Customer Review

Based on 1 Customer Validation

The P371 protein is critical in cellular processes and mediates vitamin K-dependent carboxylation of glutamate residues to form calcium-binding γ-carboxyglutamic acid (Gla) residues. At the same time, it converts the reduced hydroquinone form of vitamin K into vitamin K epoxide. P371 Protein, Human (L573F, sf9, FLAG) is the recombinant human-derived P371 protein, expressed by sf9 insect cells , with C-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • P371 Protein, Human (L573F, sf9, FLAG) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The P371 protein is critical in cellular processes and mediates vitamin K-dependent carboxylation of glutamate residues to form calcium-binding γ-carboxyglutamic acid (Gla) residues. At the same time, it converts the reduced hydroquinone form of vitamin K into vitamin K epoxide. P371 Protein, Human (L573F, sf9, FLAG) is the recombinant human-derived P371 protein, expressed by sf9 insect cells , with C-Flag labeled tag.

Background

P371 Protein plays a crucial role in cellular processes by mediating the vitamin K-dependent carboxylation of glutamate residues, converting them into calcium-binding gamma-carboxyglutamate (Gla) residues while simultaneously transforming the reduced hydroquinone form of vitamin K into vitamin K epoxide. The protein's catalytic activity extends to the gamma-carboxylation of diverse proteins, including blood coagulation factors (F2, F7, F9, and F10), osteocalcin (BGLAP), and matrix Gla protein (MGP). This enzymatic function is pivotal for the post-translational modification of these proteins, ensuring their proper biological activity, particularly in blood coagulation and bone metabolism. P371's role as a mediator in vitamin K-dependent processes highlights its significance in maintaining the functionality of various proteins critical to physiological homeostasis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-Flag
  • Accession

    P38435 (M1-F758, L573F)

  • Gene ID
    2677
  • Molecular Construction
    • N-term
    • P371 (M1-F758, L573F)
      Accession # P38435
    • Flag
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GGCX; VKCFD1; Gamma-Glutamyl Carboxylase; Vitamin K Gamma Glutamyl Carboxylase; Vitamin K-Dependent Gamma-Carboxylase; VKGC; Peptidyl-Glutamate 4-Carboxylase; GC

  • AA Sequence

    MAVSAGSARTSPSSDKVQKDKAELISGPRQDSRIGKLLGFEWTDLSSWRRLVTLLNRPTDPASLAVFRFLFGFLMVLDIPQERGLSSLDRKYLDGLDVCRFPLLDALRPLPLDWMYLVYTIMFLGALGMMLGLCYRISCVLFLLPYWYVFLLDKTSWNNHSYLYGLLAFQLTFMDANHYWSVDGLLNAHRRNAHVPLWNYAVLRGQIFIVYFIAGVKKLDADWVEGYSMEYLSRHWLFSPFKLLLSEELTSLLVVHWGGLLLDLSAGFLLFFDVSRSIGLFFVSYFHCMNSQLFSIGMFSYVMLASSPLFCSPEWPRKLVSYCPRRLQQLLPLKAAPQPSVSCVYKRSRGKSGQKPGLRHQLGAAFTLLYLLEQLFLPYSHFLTQGYNNWTNGLYGYSWDMMVHSRSHQHVKITYRDGRTGELGYLNPGVFTQSRRWKDHADMLKQYATCLSRLLPKYNVTEPQIYFDIWVSINDRFQQRIFDPRVDIVQAAWSPFQRTSWVQPLLMDLSPWRAKLQEIKSSLDNHTEVVFIADFPGLHLENFVSEDLGNTSIQLLQGEVTVELVAEQKNQTFREGEKMQLPAGEYHKVYTTSPSPSCYMYVYVNTTELALEQDLAYLQELKEKVENGSETGPLPPELQPLLEGEVKGGPEPTPLVQTFLRRQQRLQEIERRRNTPFHERFFRFLLRKLYVFRRSFLMTCISLRNLILGRPSLEQLAQEVTYANLRPFEAVGELNPSNTDSSHSNPPESNPDPVHSEF

  • Molecular Weight

    Approximately 80-85 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 10 mM DTT, 10 mM CaCl2, 0.005% GDN.
2.Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 8.0, 150 mM NaCl, 10 mM DTT, 10 mM CaCl2, 0.005% (w/v) GDN.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • P371 Protein, Human (L573F, sf9, FLAG) Product Image
    1/16
  • P371 Protein, Human (L573F, sf9, FLAG) Product Image