PAK3 Protein, Human (Active, sf9, His)

PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3 Protein, Human (sf9, His) is the recombinant human-derived PAK3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PAK3 is a serine/threonine kinase that plays a key role in multiple signaling pathways, affecting cytoskeletal dynamics, cell migration, and cell cycle. Its involvement in dendritic spine morphogenesis and synapse formation emphasizes its importance in neuronal processes. PAK3 Protein, Human (sf9, His) is the recombinant human-derived PAK3 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

PAK3, a serine/threonine protein kinase, assumes a pivotal role in diverse signaling pathways, influencing cytoskeleton dynamics, cell migration, and cell cycle regulation. Its involvement in dendritic spine morphogenesis, synapse formation, and plasticity underscores its significance in neuronal processes. As a downstream effector of small GTPases CDC42 and RAC1, PAK3 undergoes activation through their binding, triggering autophosphorylation on multiple serine and/or threonine residues. The kinase activity of PAK3 extends to phosphorylating MAPK4 and MAPK6, activating the downstream target MAPKAPK5, which modulates F-actin polymerization and cell migration. Furthermore, PAK3 phosphorylates TNNI3/troponin I, impacting calcium sensitivity and relaxation kinetics of thin myofilaments. Its indispensable role in early neuronal development is evident, particularly in hippocampal neurons, where it facilitates dendritic spine formation and excitatory synapse establishment, possibly by regulating actomyosin contractility through myosin II regulatory light chain phosphorylation. The multifaceted functions of PAK3 highlight its intricate contributions to cellular processes critical for neuronal structure and function.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PAK3 (M1-R544)
      Accession # O75914-2
    • His
    • C-term
  • Protein Length

    Full Length of Isoform-2

  • Synonyms

    PAK3; HPAK3; Prev. MRX30; PAK-3; Prev. MRX47; Adriamycin Resistance-Associated; BPAK; Mental Retardation, X-Linked 47; P21 Protein (Cdc42/Rac)-Activated Kinase 3; P21-Activated Kinase 3; Serine/Threonine-Protein Kinase PAK 3; PAK3beta; P21 (CDKN1A)-Activa

  • AA Sequence

    MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSKETVNNQKYMSFTSGDKSAHGYIAAHPSSTKTASEPPLAPPVSEEEDEEEEEEEDENEPPPVIAPRPEHTKSIYTRSVVESIASPAVPNKEVTPPSAENANSSTLYRNTDRQRKKSKMTDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTALDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLSAVFRDFLNRCLEMDVDRRGSAKELLQHPFLKLAKPLSSLTPLIIAAKEAIKNSSR

  • Predicted Molecular Mass

    62 kDa

  • Molecular Weight

    Approximately 60 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00