PARP7 Protein, Human (His, Avi)
Based on 1 Customer Validation
PARP7 Protein, Human (His, Avi) is the recombinant human-derived PARP7, expressed by E. coli , with His, Avi labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PARP7 Protein, Human (His, Avi) is the recombinant human-derived PARP7, expressed by E. coli , with His, Avi labeled tag. ,
Background
PARP7 is an ADP-ribosyltransferase that mediates mono-ADP-ribosylation of glutamate, aspartate, and cysteine residues on target proteins. It acts as a negative regulator of AHR by mono-ADP-ribosylating AHR, thereby inhibiting its transcriptional activator activity. by similar: This function is analogous to other PARP family members, though PARP7 may exhibit distinct substrate specificity and regulatory mechanisms.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;N-Avi
-
Accession
Q7Z3E1 (M456-I657)
-
Gene ID25976
-
Protein Length
Partial
-
Synonyms
TIPARP; PARP-1; TCDD Inducible Poly(ADP-Ribose) Polymerase; DDF1; ARTD14; RM1; PARP7; TCDD-Inducible Poly(ADP-Ribose) Polymerase, Isoform CRA_b; PARP-7; TCDD-Inducible Poly(ADP-Ribose) Polymerase, Isoform CRA_c; PART14; TCDD-Inducible Poly [ADP-Ribose] Po
-
AA Sequence
MHPSQDFIQVPVSAEDKSYRIIYNLFHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGSHGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIFNDDQSYPYFVIQYEEVSNTVSI
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 500 mM NaCl, 1 mM DTT, 20% glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
