PASK Protein, Human (Active, sf9, GST)
Based on 1 Customer Validation
PASK is an important serine/threonine protein kinase that complexly regulates energy homeostasis and protein translation. It phosphorylates key targets (EEF1A1, GYS1, PDX1, RPS6) in response to changing environmental conditions (e.g., oxygen levels and nutritional status). PASK Protein, Human (sf9, GST) is the recombinant human-derived PASK protein, expressed by sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PASK is an important serine/threonine protein kinase that complexly regulates energy homeostasis and protein translation. It phosphorylates key targets (EEF1A1, GYS1, PDX1, RPS6) in response to changing environmental conditions (e.g., oxygen levels and nutritional status). PASK Protein, Human (sf9, GST) is the recombinant human-derived PASK protein, expressed by sf9 insect cells , with N-GST labeled tag.
Background
PASK, a serine/threonine-protein kinase, intricately contributes to energy homeostasis and protein translation. It exerts its regulatory influence by phosphorylating key targets, including EEF1A1, GYS1, PDX1, and RPS6. Notably, PASK appears to play a pivotal role in response to changing environmental conditions, such as alterations in oxygen levels, glucose availability, and nutritional status, rather than functioning under standard conditions. Acting as a sensor for energy homeostasis, PASK orchestrates glycogen synthase synthesis through the phosphorylation of GYS1, resulting in GYS1 inactivation. While its potential involvement in glucose-stimulated insulin production in the pancreas and the regulation of glucagon secretion by glucose in alpha cells awaits further substantiation, PASK is suggested to contribute to the modulation of protein translation. By phosphorylating EEF1A1, PASK enhances translation efficiency, implicating its role in finely tuning cellular responses to varying environmental cues. Additionally, PASK's potential engagement in respiratory regulation further underscores its multifaceted role in cellular homeostasis.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q96RG2 (S949-S1323)
-
Gene ID23178
-
Molecular Construction
-
N-term
-
GST
-
PASK (S949-S1323)
Accession # Q96RG2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
PASK; PAS Domain-Containing Serine/Threonine-Protein Kinase; PAS Domain Containing Serine/Threonine Kinase; Per-Arnt-Sim (PAS) Domain Kinase; PASKIN; PAS-Kinase; KIAA0135; HPASK; STK37
-
AA Sequence
SLPGSTHSTAAELTGPSLVEVLRARPWFEEPPKAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS
-
Molecular Weight
Approximately 70 KDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl (pH 7.5), 200 mM NaCl, 0.05% Brij35, 20% glycerol, 1 mM DTT .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)