PDCD8/AIFM1 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

PDCD8/AIFM1 protein has the dual functions of NADH oxidoreductase and apoptosis regulator, and translocates from the mitochondrial intermembrane space to the cytoplasm and nucleus in response to apoptotic stimuli. It acts through a caspase-independent pathway, inducing “parthanatos” characterized by fragmentation of chromosomal DNA. PDCD8/AIFM1 Protein, Human (His) is the recombinant human-derived PDCD8/AIFM1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDCD8/AIFM1 protein has the dual functions of NADH oxidoreductase and apoptosis regulator, and translocates from the mitochondrial intermembrane space to the cytoplasm and nucleus in response to apoptotic stimuli. It acts through a caspase-independent pathway, inducing “parthanatos” characterized by fragmentation of chromosomal DNA. PDCD8/AIFM1 Protein, Human (His) is the recombinant human-derived PDCD8/AIFM1 protein, expressed by E. coli , with N-6*His labeled tag.

Background

PDCD8/AIFM1 protein exhibits dual functionality, serving as both an NADH oxidoreductase and a regulator of apoptosis. In response to apoptotic stimuli, it undergoes translocation from the mitochondrial intermembrane space to the cytosol and nucleus, functioning as a proapoptotic factor through a caspase-independent pathway. This release into the cytoplasm is facilitated by its binding to poly-ADP-ribose chains. The soluble form (AIFsol) found in the nucleus induces 'parthanatos,' characterized by caspase-independent fragmentation of chromosomal DNA. Additionally, PDCD8/AIFM1 interacts with EIF3G, inhibiting the EIF3 machinery and protein synthesis while activating caspase-7 to amplify apoptosis. It plays a critical role in caspase-independent, pyknotic cell death induced by hydrogen peroxide. In normal mitochondrial metabolism, PDCD8/AIFM1 contributes significantly to the regulation of respiratory chain biogenesis by interacting with CHCHD4 and controlling CHCHD4 mitochondrial import. Notably, PDCD8/AIFM1 demonstrates NADH oxidoreductase activity and does not induce nuclear apoptosis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • AIFM1 (E121-D613)
      Accession # O95831
    • C-term
  • Protein Length

    Partial

  • Synonyms

    AIFM1; Programmed Cell Death Protein 8; Prev. PDCD8; Apoptosis Inducing Factor, Mitochondria Associated 1; Prev. AUNX1; Striatal Apoptosis-Inducing Factor; Prev. NAMSD; Testicular Secretory Protein Li 4; AIF; Alternative Protein AIFM1; Apoptosis-Inducing

  • AA Sequence

    EEVPQDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED

  • Predicted Molecular Mass

    56.2 kDa

  • Molecular Weight

    Approximately 68 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00