1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PDE4D Protein, Human (His)

PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human (His) is the recombinant human-derived PDE4D protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human (His) is the recombinant human-derived PDE4D protein, expressed by E. coli , with N-6*His labeled tag.

Background

PDE4D (Phosphodiesterase 4D) protein functions as a hydrolytic enzyme responsible for the degradation of the second messenger cAMP. This molecule, cyclic adenosine monophosphate (cAMP), serves as a crucial regulator in numerous essential physiological processes. PDE4D's enzymatic activity in breaking down cAMP underscores its pivotal role in modulating cellular signaling cascades and maintaining the intricate balance of intracellular communication mediated by this critical second messenger.

Biological Activity

The PDE4D protein activity was detected using the AMP-Glo™ Assay method. With 10μM cAMP as the substrate, tests were conducted on PDE4D at different concentration gradients. The results showed that after 60 minutes of reaction, the substrate conversion rate exhibited a linear relationship within the range of 0.3nM PDE4D concentration. Specifically, when the enzyme concentration used was 0.1nM, the conversion rate could reach 20% after 60 minutes of reaction.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q08499 (T388-S715)

Gene ID

5144

Molecular Construction
N-term
6*His
PDE4D (T388-S715)
Accession # Q08499
C-term
Protein Length

Partial

Synonyms
PDE4D; cAMP-specific 3'; 5'-cyclic phosphodiesterase 4D; DPDE3; PDE43
AA Sequence

TEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQS

Molecular Weight

Approximately 38 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

PDE4D Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PDE4D Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PDE4D Protein, Human (His)
Cat. No.:
HY-P701961
Quantity:
MCE Japan Authorized Agent: