PDE4D Protein, Human (His)
Based on 1 Customer Validation
PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human (His) is the recombinant human-derived PDE4D protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human (His) is the recombinant human-derived PDE4D protein, expressed by E. coli , with N-6*His labeled tag.
Background
PDE4D (Phosphodiesterase 4D) protein functions as a hydrolytic enzyme responsible for the degradation of the second messenger cAMP. This molecule, cyclic adenosine monophosphate (cAMP), serves as a crucial regulator in numerous essential physiological processes. PDE4D's enzymatic activity in breaking down cAMP underscores its pivotal role in modulating cellular signaling cascades and maintaining the intricate balance of intracellular communication mediated by this critical second messenger.
Verified Bioactivity
The PDE4D protein activity was detected using the AMP-Glo™ Assay method. With 10μM cAMP as the substrate, tests were conducted on PDE4D at different concentration gradients. The results showed that after 60 minutes of reaction, the substrate conversion rate exhibited a linear relationship within the range of 0.3nM PDE4D concentration. Specifically, when the enzyme concentration used was 0.1nM, the conversion rate could reach 20% after 60 minutes of reaction.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q08499 (T388-S715)
-
Gene ID5144
-
Molecular Construction
-
N-term
-
6*His
-
PDE4D (T388-S715)
Accession # Q08499 -
C-term
-
-
Protein Length
Full Length of PDEase Domain
-
Synonyms
PDE4D; CAMP-Specific Phosphodiesterase PDE4D6; Prev. DPDE3; CAMP-Specific Phosphodiesterase 4D; CAMP-Specific 3',5'-Cyclic Phosphodiesterase 4D; Testicular Tissue Protein Li 136; 3',5'-Cyclic-AMP Phosphodiesterase 4D; Phosphodiesterase; PDE43; ACRDYS2; Ph
-
AA Sequence
TEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQS
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)