PDE4D Protein, Human
Based on 1 Customer Validation
PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human is the recombinant human-derived PDE4D protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human is the recombinant human-derived PDE4D protein, expressed by E. coli , with tag free.
Background
PDE4D (Phosphodiesterase 4D) protein functions as a hydrolytic enzyme responsible for the degradation of the second messenger cAMP. This molecule, cyclic adenosine monophosphate (cAMP), serves as a crucial regulator in numerous essential physiological processes. PDE4D's enzymatic activity in breaking down cAMP underscores its pivotal role in modulating cellular signaling cascades and maintaining the intricate balance of intracellular communication mediated by this critical second messenger.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q08499 (T388-S715)
-
Gene ID5144
-
Molecular Construction
-
N-term
-
PDE4D (T388-S715)
Accession # Q08499 -
C-term
-
-
Protein Length
Full Length of PDEase Domain
-
Synonyms
PDE4D; CAMP-Specific Phosphodiesterase PDE4D6; Prev. DPDE3; CAMP-Specific Phosphodiesterase 4D; CAMP-Specific 3',5'-Cyclic Phosphodiesterase 4D; Testicular Tissue Protein Li 136; 3',5'-Cyclic-AMP Phosphodiesterase 4D; Phosphodiesterase; PDE43; ACRDYS2; Ph
-
AA Sequence
TEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQS
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
1.Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT
.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)