PDE4D Protein, Human

Customer Review

Based on 1 Customer Validation

PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human is the recombinant human-derived PDE4D protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PDE4D (Phosphodiesterase 4D) protein, as a hydrolytic enzyme, degrades the second messenger cAMP, a crucial regulator in various physiological processes. Its enzymatic activity in breaking down cAMP underscores PDE4D's pivotal role in modulating cellular signaling cascades, maintaining the intricate balance of intracellular communication mediated by this critical second messenger. PDE4D Protein, Human is the recombinant human-derived PDE4D protein, expressed by E. coli , with tag free.

Background

PDE4D (Phosphodiesterase 4D) protein functions as a hydrolytic enzyme responsible for the degradation of the second messenger cAMP. This molecule, cyclic adenosine monophosphate (cAMP), serves as a crucial regulator in numerous essential physiological processes. PDE4D's enzymatic activity in breaking down cAMP underscores its pivotal role in modulating cellular signaling cascades and maintaining the intricate balance of intracellular communication mediated by this critical second messenger.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PDE4D (T388-S715)
      Accession # Q08499
    • C-term
  • Protein Length

    Full Length of PDEase Domain

  • Synonyms

    PDE4D; CAMP-Specific Phosphodiesterase PDE4D6; Prev. DPDE3; CAMP-Specific Phosphodiesterase 4D; CAMP-Specific 3',5'-Cyclic Phosphodiesterase 4D; Testicular Tissue Protein Li 136; 3',5'-Cyclic-AMP Phosphodiesterase 4D; Phosphodiesterase; PDE43; ACRDYS2; Ph

  • AA Sequence

    TEQEDVLAKELEDVNKWGLHVFRIAELSGNRPLTVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLSTPALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGFKLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMCDKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQS

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

1.Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
2.Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT .
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00