PDGF-BB Protein, Human (P.pastoris, His, solution)
Based on 1 Customer Validation
The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. PDGF-BB Protein, Human (P.pastoris, His) is the recombinant human-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.
- Species: Human
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The PDGF-BB protein is a key growth factor that centrally regulates embryonic development, cell proliferation, migration, survival, and chemotaxis. It is known for its potent mitogenic effects on mesenchymal cells and is essential for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in tissues such as the central nervous system, skin, lungs, heart, and placenta. PDGF-BB Protein, Human (P.pastoris, His) is the recombinant human-derived PDGF-BB protein, expressed by P. pastoris , with N-His labeled tag.
GMP PDGF-BB Protein, a pivotal growth factor, assumes a central role in regulating embryonic development, cell proliferation, migration, survival, and chemotaxis. Renowned for its potent mitogenic effects on mesenchymal cells, GMP PDGF-BB is indispensable for the normal proliferation and recruitment of pericytes and vascular smooth muscle cells in various tissues, including the central nervous system, skin, lung, heart, and placenta. Its vital contributions extend to the development of blood vessels and kidney glomeruli, highlighting its significance in vascular and renal physiology. A key participant in wound healing, GMP PDGF-BB's signaling dynamics are finely tuned through heterodimer formation with PDGFA. Present as an antiparallel homodimer, GMP PDGF-BB engages in disulfide-linked interactions with PDGFRA and PDGFRB homodimers, as well as with heterodimers formed by PDGFRA and PDGFRB. Additionally, it forms antiparallel heterodimers with PDGFA, further diversifying its regulatory repertoire. Notably, GMP PDGF-BB establishes connections with XLKD1, LRP1, and SORL1, contributing to a network of interactions that modulate its multifaceted functions.
Immobilized Recombinant Human PDGFRB / CD140b Protein at 2 μg/mL (100 μL/well) can bind Recombinant Human PDGF-B Protein (His Tag) , the EC50 is 14.64 ng/mL.
Technical Parameters
-
Species Human
-
Source P. pastoris
-
Tag N-His
-
Accession
P01127 (S82-T190)
-
Gene ID5155
-
Molecular Construction
-
N-term
-
His
-
PDGF-BB (S82-T190)
Accession # P01127 -
C-term
-
-
Protein Length
Full Length of PDGFB
-
Synonyms
PDGFB; Platelet-Derived Growth Factor 2; Prev. SIS; PDGF Subunit B; Platelet-Derived Growth Factor Beta Polypeptide; PDGF2; Platelet-Derived Growth Factor Subunit B; Platelet-Derived Growth Factor, Beta Polypeptide (Oncogene SIS); Platelet-Derived Growth
-
AA Sequence
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
-
Predicted Molecular Mass
14.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 30% Acetonitrile, 0.1% TFA.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)