PFDN5 Protein, Human (His)
Based on 1 Customer Validation
PFDN5 protein selectively binds to cytosolic chaperonin (c-CPN), facilitating targeted protein transfer and promoting nascent polypeptide folding. Beyond its chaperone function, PFDN5 regulates MYC transcriptional activity by forming a heterohexamer. It interacts with MYC's N-terminal domain, showcasing a multifaceted role in cellular processes, bridging protein folding and transcriptional regulation. PFDN5 Protein, Human (His) is the recombinant human-derived PFDN5 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PFDN5 protein selectively binds to cytosolic chaperonin (c-CPN), facilitating targeted protein transfer and promoting nascent polypeptide folding. Beyond its chaperone function, PFDN5 regulates MYC transcriptional activity by forming a heterohexamer. It interacts with MYC's N-terminal domain, showcasing a multifaceted role in cellular processes, bridging protein folding and transcriptional regulation. PFDN5 Protein, Human (His) is the recombinant human-derived PFDN5 protein, expressed by E. coli , with N-His labeled tag.
Background
PFDN5 protein demonstrates targeted binding to cytosolic chaperonin (c-CPN), facilitating the transfer of specific proteins to this chaperone. Additionally, PFDN5 binds to nascent polypeptide chains, actively supporting their proper folding within a cellular environment teeming with competing pathways for nonnative proteins. Beyond its chaperone function, PFDN5 plays a regulatory role by repressing the transcriptional activity of MYC. Structurally, PFDN5 forms a heterohexamer comprising two PFD-alpha type and four PFD-beta type subunits. Notably, it engages in specific interactions with the N-terminal domain of MYC, suggesting a multifaceted role for PFDN5 in cellular processes, encompassing both protein folding and transcriptional regulation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q99471 (M1-A154)
-
Molecular Construction
-
N-term
-
His
-
PFDN5 (M1-A154)
Accession # Q99471 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PFDN5; C-Myc-Binding Protein Mm-1; Prefoldin Subunit 5; C-Myc Binding Protein; PFD5; Myc Modulator-1; MM-1; Myc Modulator 1; MM1; Prefoldin 5
-
AA Sequence
MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, 5% trehalose, 5% mannitol and 0.01% Tween 80, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
