PI4K2A Protein, Human (His, GST)
PI4K2A Protein, Human (His, GST) is the recombinant human-derived PI4K2A, expressed by E. coli , with His, GST labeled tag. ,
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PI4K2A Protein, Human (His, GST) is the recombinant human-derived PI4K2A, expressed by E. coli , with His, GST labeled tag. ,
Background
PI4K2A is a membrane-bound phosphatidylinositol-4 kinase that catalyzes the phosphorylation of phosphatidylinositol (PI) to phosphatidylinositol 4-phosphate (PI4P). PI4P is a crucial lipid involved in endocytosis, Golgi function, protein sorting, and membrane trafficking, and it is essential for the prolonged survival of neurons. Additionally, the phosphorylation of PI to PI4P represents the first committed step in generating phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag His;GST
-
Accession
Q9BTU6 (D2-W479)
-
Gene ID55361
-
Protein Length
Full Length
-
Synonyms
PI4K2A; Phosphatidylinositol 4-Kinase Type 2-Alpha; Phosphatidylinositol 4-Kinase Type 2 Alpha; DKFZP761G1923; PI4KII; Phosphatidylinositol 4-Kinase Type II (PI4KII); PIK42A; NEDMSB; Phosphatidylinositol 4-Kinase Type II-Alpha
-
AA Sequence
DETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
-
Predicted Molecular Mass
81.6 kDa
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
