PIGR Protein, Human (HEK293, Twin-Strep)
Based on 1 Customer Validation
PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR, Human (HEK293, Twin-Strep) is the recombinant human-derived PIGR protein, expressed by HEK293, with C-Twin-Strep labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR, Human (HEK293, Twin-Strep) is the recombinant human-derived PIGR protein, expressed by HEK293, with C-Twin-Strep labeled tag.
Background
PIGR Protein assumes a crucial role in mediating the selective transcytosis of polymeric IgA and IgM across mucosal epithelial cells, orchestrating a process essential for mucosal immunity. The protein binds polymeric IgA and IgM at the basolateral surface of epithelial cells, forming a complex that is subsequently transported across the cell and secreted at the apical surface. During this transit, a cleavage event occurs, separating the extracellular component, known as the secretory component, from the transmembrane segment. PIGR, through its N-linked glycans, ensures the anchoring of secretory IgA (sIgA) molecules to the mucus lining the epithelial surface, a critical mechanism for neutralizing extracellular pathogens. In its free form, PIGR may also function as a non-specific microbial scavenger, playing a role in preventing pathogen interaction with epithelial cells and contributing to the broader defense against potential infections.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Twin-Strep
-
Accession
P01833 (K19-R603)
-
Gene ID5284
-
Molecular Construction
-
N-term
-
PIGR (K19-R603)
Accession # P01833 -
Twin-Strep
-
C-term
-
-
Protein Length
Full Length of Secretory component
-
Synonyms
PIGR; Hepatocellular Carcinoma Associated Protein TB6; Polymeric Immunoglobulin Receptor; Hepatocellular Carcinoma-Associated Protein TB6; Poly-Ig Receptor; PIgR
-
AA Sequence
KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPR
-
Predicted Molecular Mass
67.6 kDa
-
Molecular Weight
Approximately 80-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)