PIGR Protein, Human (HEK293, Twin-Strep)

Customer Review

Based on 1 Customer Validation

PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR, Human (HEK293, Twin-Strep) is the recombinant human-derived PIGR protein, expressed by HEK293, with C-Twin-Strep labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PIGR proteins play a critical role in mediating the selective transcytosis of polymerized IgA and IgM across mucosal epithelial cells, which is critical for mucosal immunity. PIGR binds these immunoglobulins at the basolateral surface, forming a complex that is transported intracellularly and secreted apically. PIGR, Human (HEK293, Twin-Strep) is the recombinant human-derived PIGR protein, expressed by HEK293, with C-Twin-Strep labeled tag.

Background

PIGR Protein assumes a crucial role in mediating the selective transcytosis of polymeric IgA and IgM across mucosal epithelial cells, orchestrating a process essential for mucosal immunity. The protein binds polymeric IgA and IgM at the basolateral surface of epithelial cells, forming a complex that is subsequently transported across the cell and secreted at the apical surface. During this transit, a cleavage event occurs, separating the extracellular component, known as the secretory component, from the transmembrane segment. PIGR, through its N-linked glycans, ensures the anchoring of secretory IgA (sIgA) molecules to the mucus lining the epithelial surface, a critical mechanism for neutralizing extracellular pathogens. In its free form, PIGR may also function as a non-specific microbial scavenger, playing a role in preventing pathogen interaction with epithelial cells and contributing to the broader defense against potential infections.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Twin-Strep
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PIGR (K19-R603)
      Accession # P01833
    • Twin-Strep
    • C-term
  • Protein Length

    Full Length of Secretory component

  • Synonyms

    PIGR; Hepatocellular Carcinoma Associated Protein TB6; Polymeric Immunoglobulin Receptor; Hepatocellular Carcinoma-Associated Protein TB6; Poly-Ig Receptor; PIgR

  • AA Sequence

    KSPIFGPEEVNSVEGNSVSITCYYPPTSVNRHTRKYWCRQGARGGCITLISSEGYVSSKYAGRANLTNFPENGTFVVNIAQLSQDDSGRYKCGLGINSRGLSFDVSLEVSQGPGLLNDTKVYTVDLGRTVTINCPFKTENAQKRKSLYKQIGLYPVLVIDSSGYVNPNYTGRIRLDIQGTGQLLFSVVINQLRLSDAGQYLCQAGDDSNSNKKNADLQVLKPEPELVYEDLRGSVTFHCALGPEVANVAKFLCRQSSGENCDVVVNTLGKRAPAFEGRILLNPQDKDGSFSVVITGLRKEDAGRYLCGAHSDGQLQEGSPIQAWQLFVNEESTIPRSPTVVKGVAGGSVAVLCPYNRKESKSIKYWCLWEGAQNGRCPLLVDSEGWVKAQYEGRLSLLEEPGNGTFTVILNQLTSRDAGFYWCLTNGDTLWRTTVEIKIIEGEPNLKVPGNVTAVLGETLKVPCHFPCKFSSYEKYWCKWNNTGCQALPSQDEGPSKAFVNCDENSRLVSLTLNLVTRADEGWYWCGVKQGHFYGETAAVYVAVEERKAAGSRDVSLAKADAAPDEKVLDSGFREIENKAIQDPR

  • Predicted Molecular Mass

    67.6 kDa

  • Molecular Weight

    Approximately 80-100 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00