Copy Link Print Information

PILR-alpha Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

PILR-alpha Protein, a key member of paired immune system regulators, acts as a receptor for CD99 and PIANP. Its interactions with CD99 highlight its role in cellular recognition and immune response modulation. Paired receptors, featuring activating and inhibitory forms, finely tune immune system regulation. PILR-alpha's observed ligand interactions underscore its importance in mediating immune responses and cellular recognition processes. PILR-alpha Protein, Mouse (HEK293, His) is the recombinant mouse-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • PILR-alpha Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PILR-alpha Protein, a key member of paired immune system regulators, acts as a receptor for CD99 and PIANP. Its interactions with CD99 highlight its role in cellular recognition and immune response modulation. Paired receptors, featuring activating and inhibitory forms, finely tune immune system regulation. PILR-alpha's observed ligand interactions underscore its importance in mediating immune responses and cellular recognition processes. PILR-alpha Protein, Mouse (HEK293, His) is the recombinant mouse-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.

Background

PILR-alpha Protein, a member of paired receptors pivotal in immune system regulation, serves as a receptor for CD99 and PIANP. Its involvement in interactions with CD99 underscores its role in cellular recognition and immune response modulation. Paired receptors, characterized by closely related activating and inhibitory forms, play a crucial role in finely tuning the regulatory mechanisms of the immune system. The observed interactions with specific ligands emphasize PILR-alpha's significance in mediating immune responses and cellular recognition processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse PILRA at 20 μg/mL (100 μl/well) can bind mouse CD99 . The EC50 of mouse CD99 is ≤2 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q2YFS3 (E32-V197)

  • Gene ID
    231805  [NCBI]
  • Molecular Construction
    • N-term
    • PILR-alpha (E32-V197)
      Accession # Q2YFS3
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    PILRA; Inhibitory Receptor PILR-Alpha; Paired Immunoglobin Like Type 2 Receptor Alpha; Cell Surface Receptor FDF03; FDF03; Paired Immunoglobin-Like Type 2 Receptor Alpha; Paired Immunoglobulin-Like Type 2 Receptor Alpha

  • AA Sequence

    ERSNRKNGFGVNQPESCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWRWKDFHGEFIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQTRYFGRVFLQTTEGIQFWQSIPGTQLNVTNATCTPTTLPSTTAATSAHTQNDITEVKSANIGGLDLQTTV

  • Predicted Molecular Mass

    20.2 kDa

  • Molecular Weight

    Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PILR-alpha Protein, Mouse (HEK293, His) Product Image
    1/16
  • PILR-alpha Protein, Mouse (HEK293, His) Product Image