PILR-alpha Protein, Mouse (HEK293, His)

PILR-alpha Protein, a key member of paired immune system regulators, acts as a receptor for CD99 and PIANP. Its interactions with CD99 highlight its role in cellular recognition and immune response modulation. Paired receptors, featuring activating and inhibitory forms, finely tune immune system regulation. PILR-alpha's observed ligand interactions underscore its importance in mediating immune responses and cellular recognition processes. PILR-alpha Protein, Mouse (HEK293, His) is the recombinant mouse-derived PILR-alpha protein, expressed by HEK293 , with C-His labeled tag.

PILR-alpha Protein, a member of paired receptors pivotal in immune system regulation, serves as a receptor for CD99 and PIANP. Its involvement in interactions with CD99 underscores its role in cellular recognition and immune response modulation. Paired receptors, characterized by closely related activating and inhibitory forms, play a crucial role in finely tuning the regulatory mechanisms of the immune system. The observed interactions with specific ligands emphasize PILR-alpha's significance in mediating immune responses and cellular recognition processes.

Measured by its binding ability in a functional ELISA. Immobilized recombinant mouse PILRA at 20 μg/mL (100 μl/well) can bind mouse CD99 . The EC₅₀ of mouse CD99 is ≤2 μg/mL.

Mouse

HEK293

C-His

Q2YFS3 (E32-V197)

231805  [NCBI]

Extracellular Domain

ERSNRKNGFGVNQPESCSGVQGGSIDIPFSFYFPWKLAKDPQMSIAWRWKDFHGEFIYNSSLPFIHEHFKGRLILNWTQGQTSGVLRILNLKESDQTRYFGRVFLQTTEGIQFWQSIPGTQLNVTNATCTPTTLPSTTAATSAHTQNDITEVKSANIGGLDLQTTV

35-45 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.