PILR-beta Protein, Human (HEK293, His)
Based on 1 Customer Validation
PILR-β is part of a family of paired receptors that play a critical regulatory role in the immune system. PILR-β functions as an activating receptor and is thought to participate in cell signaling by binding to ITAM-bearing adapter molecules, suggesting its role in transmitting immune response signals. PILR-beta Protein, Human (HEK293, His) is the recombinant human-derived PILR-beta protein, expressed by HEK293 , with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PILR-β is part of a family of paired receptors that play a critical regulatory role in the immune system. PILR-β functions as an activating receptor and is thought to participate in cell signaling by binding to ITAM-bearing adapter molecules, suggesting its role in transmitting immune response signals. PILR-beta Protein, Human (HEK293, His) is the recombinant human-derived PILR-beta protein, expressed by HEK293 , with N-His labeled tag.
Background
PILR-beta, a member of the paired receptors family, plays a crucial role in immune system regulation. As an activating receptor, PILRB is believed to engage in cellular signaling by associating with ITAM-bearing adapter molecules on the cell surface. This interaction suggests its involvement in transmitting signals that contribute to immune responses and modulation. The duality of activating and inhibitory receptors within the paired receptors family underscores their significance in finely tuning immune system activities.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized CL-P1 at 2μg/mL (100μL/well) can bind Biotinylated Human PILR-beta. The ED50 for this effect is 1.808 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-6*His
-
Accession
Q9UKJ0-1 (Q20-A189)
-
Molecular Construction
-
N-term
-
His
-
PILR-beta (Q20-A189)
Accession # Q9UKJ0-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
PILRB; Paired Immunoglobulin-Like Receptor Beta; Paired Immunoglobin Like Type 2 Receptor Beta; Paired Immunoglobin-Like Receptor Beta; FDFACT1; Cell Surface Receptor FDFACT1; FDFACT2; Cell Surface Receptor FDFACT2; Paired Immunoglobulin-Like Type 2 Recep
-
AA Sequence
QPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTA
-
Molecular Weight
Approximately 30-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
