1. Recombinant Proteins
  2. Viral Proteins
  3. SARS-CoV-2 PL-PRO Protein (His)

The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. SARS-CoV-2 PL-PRO Protein (His) is the recombinant Virus-derived PL-PRO protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The multifunctional PL-PRO protein plays a critical role in viral RNA transcription and replication, providing the necessary proteases for multiprotein cleavage. It strategically blocks host translation by binding to the open head conformation of the 40S subunit, impeding ribosomal mRNA entry into the tunnel. SARS-CoV-2 PL-PRO Protein (His) is the recombinant Virus-derived PL-PRO protein, expressed by E. coli , with N-6*His labeled tag.

Background

The PL-PRO protein emerges as a multifunctional key player in the intricate processes of transcription and replication of viral RNAs, hosting crucial proteinases responsible for polyprotein cleavages. Functionally strategic, it impedes host translation by associating with the open head conformation of the 40S subunit, and its C-terminus intricately binds to and obstructs the ribosomal mRNA entry tunnel. This interference plays a pivotal role in suppressing the antiviral response triggered by innate immunity or interferons. The collaborative formation of the nsp1-40S ribosome complex, orchestrated by PL-PRO, induces an endonucleolytic cleavage near the 5'UTR of host mRNAs, marking them for degradation. Notably, viral mRNAs exhibit heightened resistance to the nsp1-mediated inhibition of translation, attributed to their distinctive 5'-end leader sequence. The multifaceted functions of PL-PRO underscore its indispensable role in manipulating host cellular processes, facilitating viral replication, and evading host defenses.

Species

Virus

Source

E. coli

Tag

N-6*His

Accession

P0DTC1-1 (E1564-T1875)

Gene ID

43740578

Molecular Construction
N-term
6*His
PL-PRO (E1-T312)
Accession # P0DTC1
C-term
Protein Length

Partial

Synonyms
Replicase polyprotein 1a; pp1a; ORF1a polyprotein
AA Sequence

EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTT

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

SARS-CoV-2 PL-PRO Protein (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

SARS-CoV-2 PL-PRO Protein (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
SARS-CoV-2 PL-PRO Protein (His)
Cat. No.:
HY-P702190
Quantity:
MCE Japan Authorized Agent: