1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PLA2G2A Protein, Mouse (P.pastoris, His)

PLA2G2A Protein, a phospholipase A2 enzyme, efficiently hydrolyzes phosphatidylethanolamines and phosphatidylglycerols, contributing to lipid membrane remodeling and generating lipid mediators crucial for pathogen clearance.PLA2G2A Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PLA2G2A protein, expressed by P.pastoris , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PLA2G2A Protein, a phospholipase A2 enzyme, efficiently hydrolyzes phosphatidylethanolamines and phosphatidylglycerols, contributing to lipid membrane remodeling and generating lipid mediators crucial for pathogen clearance.PLA2G2A Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PLA2G2A protein, expressed by P.pastoris , with C-His labeled tag.

Background

This passage describes the activity and functions of a phospholipase A2 enzyme. Phospholipase A2 is an enzyme that hydrolyzes phospholipids, specifically phosphatidylethanolamines and phosphatidylglycerols, more efficiently than phosphatidylcholines. This enzyme is involved in lipid remodeling of cellular membranes and the generation of lipid mediators that are important in clearing pathogens from the body.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

P. pastoris

Tag

C-His

Accession

P31482 (N22-C146)

Gene ID
Molecular Construction
N-term
PLA2G2A (N22-C146)
Accession # P31482
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Phospholipase A2, membrane associated; EF; GIIC sPLA2
AA Sequence

NIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC

Molecular Weight

Approximately 15.3 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM NaAC, pH 4.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PLA2G2A Protein, Mouse (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PLA2G2A Protein, Mouse (P.pastoris, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PLA2G2A Protein, Mouse (P.pastoris, His)
Cat. No.:
HY-P74628
Quantity:
MCE Japan Authorized Agent: