PLA2G2A Protein, Mouse (P.pastoris, His)
Based on 3 publication(s) in Google Scholar
PLA2G2A Protein, a phospholipase A2 enzyme, efficiently hydrolyzes phosphatidylethanolamines and phosphatidylglycerols, contributing to lipid membrane remodeling and generating lipid mediators crucial for pathogen clearance.PLA2G2A Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PLA2G2A protein, expressed by P.pastoris , with C-His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PLA2G2A Protein, a phospholipase A2 enzyme, efficiently hydrolyzes phosphatidylethanolamines and phosphatidylglycerols, contributing to lipid membrane remodeling and generating lipid mediators crucial for pathogen clearance.PLA2G2A Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived PLA2G2A protein, expressed by P.pastoris , with C-His labeled tag.
Background
This passage describes the activity and functions of a phospholipase A2 enzyme. Phospholipase A2 is an enzyme that hydrolyzes phospholipids, specifically phosphatidylethanolamines and phosphatidylglycerols, more efficiently than phosphatidylcholines. This enzyme is involved in lipid remodeling of cellular membranes and the generation of lipid mediators that are important in clearing pathogens from the body.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Free Radic Biol Med
Phospholipase A2 group IIA activates Indoleamine 2,3-dioxygenase 1 to drive the progression of pulmonary fibrosis. [Abstract]2025 Sep:237:251-269. PMID: 40473047 -
Life Sci
Identification and immunological characterization of PLA2G2A and cell death-associated molecular clusters in idiopathic pulmonary fibrosis. [Abstract]2023 Oct 15:331:122071. PMID: 37673297 -
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag C-His
-
Accession
P31482 (N22-C146)
-
Molecular Construction
-
N-term
-
PLA2G2A (N22-C146)
Accession # P31482 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PLA2G2A; Non-Pancreatic Secretory Phospholipase A2; Prev. PLA2B; Phospholipase A2; Prev. PLA2L; RASF-A; Phosphatidylcholine 2-Acylhydrolase 2A; PLA2S; Phospholipase A2, Membrane Associated; PLAS1; Group IIA Phospholipase A2; SPLA2; GIIC SPLA2; MOM1; Phosp
-
AA Sequence
NIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC
-
Predicted Molecular Mass
15.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM NaAC, pH 4.0, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
