PLBD2 Protein, Mouse (His)

PLBD2 Protein, a putative phospholipase, interacts with insulin-like growth factor 2 receptor (IGF2R), suggesting involvement in growth and signaling pathways. Despite unknown details about its phospholipase activity, PLBD2's exploration may unveil insights into its role in cellular homeostasis and regulatory mechanisms. PLBD2 Protein, Mouse (His) is the recombinant mouse-derived PLBD2 protein, expressed by E. coli , with N-His labeled tag. The total length of PLBD2 Protein, Mouse (His) is 548 a.a., with molecular weight of ~65.9 kDa.

PLBD2 protein, identified as a putative phospholipase, exhibits interactions with insulin-like growth factor 2 receptor (IGF2R). The precise nature of its phospholipase activity and its potential implications in cellular processes remain areas of interest, as the protein's interaction with IGF2R suggests a role in pathways associated with growth and signaling. Further exploration of PLBD2's functional characteristics may provide insights into its contribution to cellular homeostasis and regulatory mechanisms.

Mouse

E. coli

N-His

Q3TCN2 (47L-594D)

71772  [NCBI]

LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Approximately 65.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.