PPIH Protein, Human (His)
Based on 1 Customer Validation
The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PPIH protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of prolyl imide peptide bonds and may contribute to protein folding. It plays a crucial role in pre-mRNA splicing and contributes to the formation of the U4/U5/U6 tri-snRNP complex in spliceosome assembly. PPIH Protein, Human (His) is the recombinant human-derived PPIH protein, expressed by E. coli , with N-6*His labeled tag.
PPIH Protein functions as a peptidyl-prolyl cis-trans isomerase (PPIase), facilitating the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and potentially aiding in protein folding. Beyond its role in protein folding, PPIH actively participates in pre-mRNA splicing, suggesting involvement in the intricate process of spliceosome assembly. Specifically, it may contribute to the formation of the U4/U5/U6 tri-snRNP complex, a fundamental component of the spliceosome. This multifunctional role implies that PPIH may act as a chaperone, highlighting its versatile involvement in both protein folding and the regulation of essential cellular processes related to mRNA splicing. Further exploration is warranted to elucidate the specific molecular mechanisms and cellular contexts through which PPIH exerts its functions in protein homeostasis and pre-mRNA splicing.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O43447-1 (M1-M177)
-
Molecular Construction
-
N-term
-
6*His
-
PPIH (M1-M177)
Accession # O43447-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PPIH; U-SnRNP-Associated Cyclophilin SunCyp-20; Peptidylprolyl Isomerase H; U-SnRNP-Associated Cyclophilin SnuCyp-20; USA-CYP; USA-CyP SnuCyp-20; CYPH; Cyclophilin H; Small Nuclear Ribonucleoprotein Particle-Specific Cyclophilin H; MGC5016; Peptidyl-Proly
-
AA Sequence
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
-
Predicted Molecular Mass
21.4 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
