PR-Set7 Protein, Human
Based on 1 Customer Validation
The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.
The PR-Set7 protein is a protein-lysine N-methyltransferase responsible for monomethylating Lys-20 of histone H4, leading to the transcriptional repression of specific genes. It plays a crucial role in cell proliferation and contributes to chromatin condensation. The protein exhibits widespread expression in various tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and 25 other tissues.
Measured in a cell proliferation assay using MDA-MB-231 cells. The ED50 for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×104 units/mg.
-
Measured in a cell proliferation assay using MDA-MB-231 cells. The ED50 for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×104 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9NQR1-2/NP_065115 (K195-H352)
-
Molecular Construction
-
N-term
-
PR-Set7 (K195-H352)
Accession # Q9NQR1-2/NP_065115 -
C-term
-
-
Protein Length
Partial
-
Synonyms
N-lysine methyltransferase KMT5A; PR-Set7; KMT5A; PRSET7; SET8; SETD8
-
AA Sequence
KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
-
Molecular Weight
Approximately 18 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
-
≥ 95%, as determined by reducing SDS-PAGE.
-
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
