Copy Link Print Information

PR-Set7 Protein, Human

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PR-Set7 Protein, Human
  • Experimental Validation Results for PR-Set7 Protein, Human
  • PR-Set7 Protein, Human Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.

Background

The PR-Set7 protein is a protein-lysine N-methyltransferase responsible for monomethylating Lys-20 of histone H4, leading to the transcriptional repression of specific genes. It plays a crucial role in cell proliferation and contributes to chromatin condensation. The protein exhibits widespread expression in various tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and 25 other tissues.

Verified Bioactivity

Measured in a cell proliferation assay using MDA-MB-231 cells. The ED50 for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using MDA-MB-231 cells. The ED50 for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×104 units/mg.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession

    Q9NQR1-2/NP_065115 (K195-H352)

  • Gene ID
    387893  [NCBI]
  • Molecular Construction
    • N-term
    • PR-Set7 (K195-H352)
      Accession # Q9NQR1-2/NP_065115
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KMT5A; Lysine N-Methyltransferase 5A; Prev. SETD8; H4-K20-HMTase KMT5A; PR-Set7; PR/SET07; SET07; [Histone H4]-Lysine(20) N-Methyltransferase; SET8; H4-K20-Specific Histone Methyltransferase; SET Domain Containing (Lysine Methyltransferase) 8; Histone-Lys

  • AA Sequence

    KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured in a cell proliferation assay using MDA-MB-231 cells. The ED50 for this effect is 26.51 ng/mL, corresponding to a specific activity is 3.772×104 units/mg.

  • PR-Set7 Protein, Human Product Image
    1/16
  • Experimental Validation Results for PR-Set7 Protein, Human
  • Experimental Validation Results for PR-Set7 Protein, Human
  • PR-Set7 Protein, Human Product Image