PRADC1 Protein, Human (HEK293, His)
PRADC1 Protein, Human (HEK293, His) is a recombinant human protease-associated domain-containing 1 (PRADC1) produced in HEK293 cells, with His tag. PRADC1 is a metabolic-responsive secretory protein that modulates physical activity and adiposity.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
PRADC1 Protein, Human (HEK293, His) is a recombinant human protease-associated domain-containing 1 (PRADC1) produced in HEK293 cells, with His tag. PRADC1 is a metabolic-responsive secretory protein that modulates physical activity and adiposity[1].
Background
PRADC1 (also known as PAP21) is an ∼30-kDa N-glycosylated secretory protein with a protease-associated domain. PRADC1 is secreted regulator of energy metabolism[1].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9BSG0 (H22-W188)
-
Gene ID84279 [NCBI]
-
Molecular Construction
-
N-term
-
PRADC1 (H22-W188)
Accession # Q9BSG0 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRADC1; Protease-Associated Domain-Containing Glycoprotein 21 KDa; Prev. C2orf7; Protease-Associated Domain-Containing Protein 1; PAP21; MGC13004; HPAP21; Chromosome 2 Open Reading Frame 7; Protease Associated Domain Containing 1; Protease-Associated Doma
-
AA Sequence
HGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
