CNPY4/PRAT4B Protein, Mouse (HEK293, His)

PRAT4B/CNPY4 Protein is pivotal in regulating TLR4 cell surface expression, actively orchestrating cellular processes. Direct interaction with TLR4 underscores its crucial involvement, emphasizing significance in steering molecular pathways. This dynamic interplay highlights PRAT4B/CNPY4's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades. CNPY4/PRAT4B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRAT4B/CNPY4 protein, expressed by HEK293 , with C-His labeled tag.

The PRAT4B/CNPY4 protein plays a pivotal role in regulating the cell surface expression of TLR4, actively engaging in the orchestration of cellular processes. Its direct interaction with TLR4 underscores its crucial involvement, emphasizing its significance in steering molecular pathways. This dynamic interplay between PRAT4B/CNPY4 and TLR4 highlights the protein's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades.

Mouse

HEK293

C-His

Q8BQ47 (E28-L245)

66455  [NCBI]

Full Length of Mature Protein

EATKEEEDDTERLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISDGQEEADDEEEEEEEEITKTSGNPKHDPEDL

Approximately 27 kDa.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.