Copy Link Print Information

CNPY4/PRAT4B Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

PRAT4B/CNPY4 Protein is pivotal in regulating TLR4 cell surface expression, actively orchestrating cellular processes. Direct interaction with TLR4 underscores its crucial involvement, emphasizing significance in steering molecular pathways. This dynamic interplay highlights PRAT4B/CNPY4's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades. CNPY4/PRAT4B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRAT4B/CNPY4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CNPY4/PRAT4B Protein, Mouse (HEK293, His)
  • CNPY4/PRAT4B Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PRAT4B/CNPY4 Protein is pivotal in regulating TLR4 cell surface expression, actively orchestrating cellular processes. Direct interaction with TLR4 underscores its crucial involvement, emphasizing significance in steering molecular pathways. This dynamic interplay highlights PRAT4B/CNPY4's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades. CNPY4/PRAT4B Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRAT4B/CNPY4 protein, expressed by HEK293 , with C-His labeled tag.

Background

The PRAT4B/CNPY4 protein plays a pivotal role in regulating the cell surface expression of TLR4, actively engaging in the orchestration of cellular processes. Its direct interaction with TLR4 underscores its crucial involvement, emphasizing its significance in steering molecular pathways. This dynamic interplay between PRAT4B/CNPY4 and TLR4 highlights the protein's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession

    Q8BQ47 (E28-L245)

  • Gene ID
    66455  [NCBI]
  • Molecular Construction
    • N-term
    • PRAT4B (E28-L245)
      Accession # Q8BQ47
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CNPY4; Protein Canopy Homolog 4; Canopy FGF Signaling Regulator 4; MGC40499; PRAT4B; Canopy 4 Homolog (Zebrafish); Protein Associated With TLR4; Canopy 4 Homolog

  • AA Sequence

    EATKEEEDDTERLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISDGQEEADDEEEEEEEEITKTSGNPKHDPEDL

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • CNPY4/PRAT4B Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for CNPY4/PRAT4B Protein, Mouse (HEK293, His)
  • CNPY4/PRAT4B Protein, Mouse (HEK293, His) Product Image