1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PRIM1 Protein, Human (His, StrepⅡ)

The PRIM1 protein is the catalytic subunit of the DNA primase complex and is essential for the initiation of DNA synthesis. PRIM1 Protein, Human (His, Strep) is the recombinant human-derived PRIM1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PRIM1 protein is the catalytic subunit of the DNA primase complex and is essential for the initiation of DNA synthesis. PRIM1 Protein, Human (His, Strep) is the recombinant human-derived PRIM1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.

Background

PRIM1, the catalytic subunit of the DNA primase complex and a vital component of the DNA polymerase alpha complex, plays a crucial role in the initiation of DNA synthesis. During the S phase of the cell cycle, the DNA polymerase alpha complex, comprising POLA1, POLA2, PRIM1, and PRIM2, is recruited to DNA replicative forks through direct interactions with MCM10 and WDHD1. Within this complex, PRIM1 initiates DNA synthesis by oligomerizing short RNA primers on both leading and lagging strands. The primers are subsequently extended by the polymerase alpha catalytic subunit and transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strands, respectively. In the primase complex, both subunits are indispensable for the initial di-nucleotide formation, while the extension of the primer depends solely on the catalytic subunit. PRIM1 synthesizes 9-mer RNA primers, known as 'unit length' RNA primers, incorporating ribonucleotides in the presence of ribo- and deoxy-nucleotide triphosphates (rNTPs, dNTPs). The initiation of RNA primer synthesis by PRIM1 requires a template thymine or cytidine, with an adenine or guanine at its 5'-end, and exhibits binding affinity for single-stranded DNA.

Species

Human

Source

E. coli

Tag

N-StrepⅡ;N-6*His

Accession

P49642 (M1-F420)

Gene ID

5557

Molecular Construction
N-term
StrepⅡ-6*His
PRIM1 (M1-F420)
Accession # P49642
C-term
Protein Length

Full Length

Synonyms
PRIM1; DNA primase small subunit; DNA primase 49 kDa subunit; p49
AA Sequence

METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PRIM1 Protein, Human (His, StrepⅡ) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRIM1 Protein, Human (His, StrepⅡ)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRIM1 Protein, Human (His, StrepⅡ)
Cat. No.:
HY-P701969
Quantity:
MCE Japan Authorized Agent: