PRIM1 Protein, Human (His, StrepⅡ)
The PRIM1 protein is the catalytic subunit of the DNA primase complex and is essential for the initiation of DNA synthesis. PRIM1 Protein, Human (His, Strep) is the recombinant human-derived PRIM1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
The PRIM1 protein is the catalytic subunit of the DNA primase complex and is essential for the initiation of DNA synthesis. PRIM1 Protein, Human (His, Strep) is the recombinant human-derived PRIM1 protein, expressed by E. coli , with N-Strep, N-6*His labeled tag.
PRIM1, the catalytic subunit of the DNA primase complex and a vital component of the DNA polymerase alpha complex, plays a crucial role in the initiation of DNA synthesis. During the S phase of the cell cycle, the DNA polymerase alpha complex, comprising POLA1, POLA2, PRIM1, and PRIM2, is recruited to DNA replicative forks through direct interactions with MCM10 and WDHD1. Within this complex, PRIM1 initiates DNA synthesis by oligomerizing short RNA primers on both leading and lagging strands. The primers are subsequently extended by the polymerase alpha catalytic subunit and transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strands, respectively. In the primase complex, both subunits are indispensable for the initial di-nucleotide formation, while the extension of the primer depends solely on the catalytic subunit. PRIM1 synthesizes 9-mer RNA primers, known as 'unit length' RNA primers, incorporating ribonucleotides in the presence of ribo- and deoxy-nucleotide triphosphates (rNTPs, dNTPs). The initiation of RNA primer synthesis by PRIM1 requires a template thymine or cytidine, with an adenine or guanine at its 5'-end, and exhibits binding affinity for single-stranded DNA.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-StrepⅡ;N-6*His
-
Accession
P49642 (M1-F420)
-
Gene ID5557
-
Molecular Construction
-
N-term
-
StrepⅡ-6*His
-
PRIM1 (M1-F420)
Accession # P49642 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PRIM1; Primase Polypeptide 1, 49kDa; DNA Primase Subunit 1; DNA Primase Subunit 48; Primase, DNA, Polypeptide 1 (49kDa); Primase P49 Subunit; DNA Primase 49 KDa Subunit; DNA Primase AEP; DNA Primase Small Subunit; DNA Primase 1; Primase (DNA) Subunit 1; D
-
AA Sequence
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)