PRKACB Protein, Human (Active, sf9)
Based on 1 Customer Validation
PRKACB Protein, Human (sf9) is the recombinant human-derived PRKACB, expressed by Sf9 insect cells , with tag Free labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
PRKACB Protein, Human (sf9) is the recombinant human-derived PRKACB, expressed by Sf9 insect cells , with tag Free labeled tag. ,
PRKACB is a protein kinase that mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation, microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as intracellular transport mechanisms and ion flux. PRKACB controls the abundance of compartmentalized pools of its regulatory subunits by phosphorylating PJA2, which binds and ubiquitinates these subunits, leading to their proteolysis. Additionally, PRKACB phosphorylates GPKOW, regulating its RNA-binding ability. By similar function (by similar): PRKACB also acts as a negative regulator of mTORC1 by mediating phosphorylation of RPTOR.
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.025 nM, the conversion rate is about 25%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P22694-1 (G2-F351)
-
Gene ID5567
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Synonyms
PRKACB; Protein Kinase, CAMP-Dependent, Beta Catalytic Subunit; Protein Kinase CAMP-Activated Catalytic Subunit Beta; Protein Kinase, CAMP-Dependent, Catalytic, Beta; CAMP-Dependent Protein Kinase Catalytic Subunit Beta; Protein Kinase A Catalytic Subunit
-
AA Sequence
GNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
-
Predicted Molecular Mass
40.6 kDa
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
