1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. PKA
  5. PRKACB/PKAc beta
  6. PRKACB Protein, Human (Active, sf9)

PRKACB Protein, Human (sf9) is the recombinant human-derived PRKACB, expressed by Sf9 insect cells , with tag Free labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRKACB Protein, Human (sf9) is the recombinant human-derived PRKACB, expressed by Sf9 insect cells , with tag Free labeled tag. ,

Background

PRKACB is a protein kinase that mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation, microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as intracellular transport mechanisms and ion flux. PRKACB controls the abundance of compartmentalized pools of its regulatory subunits by phosphorylating PJA2, which binds and ubiquitinates these subunits, leading to their proteolysis. Additionally, PRKACB phosphorylates GPKOW, regulating its RNA-binding ability. By similar function (by similar): PRKACB also acts as a negative regulator of mTORC1 by mediating phosphorylation of RPTOR.

Biological Activity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 0.025 nM, the conversion rate is about 25%.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

P22694-1 (G2-F351)

Gene ID

5567

Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
PRKACB; protein kinase, cAMP-dependent, catalytic, beta; cAMP-dependent protein kinase catalytic subunit beta; PKACb; PKA C-beta; protein kinase A catalytic subunit beta; cAMP-dependent protein kinase catalytic beta subunit isoform 4ab; PKACB; MGC9320; MGC41879; DKFZp781I2452
AA Sequence

GNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF

Molecular Weight

40.6 KDa

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRKACB Protein, Human (Active, sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKACB Protein, Human (Active, sf9)
Cat. No.:
HY-P702637
Quantity:
MCE Japan Authorized Agent: