1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. PRKN Protein, Mouse (GST)

PRKN Protein, Mouse (GST) is the recombinant mouse-derived PRKN, expressed by E. coli , with N-GST labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

PRKN Protein, Mouse (GST) is the recombinant mouse-derived PRKN, expressed by E. coli , with N-GST labeled tag. ,

Background

PRKN functions as a component of a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin to substrate proteins such as SYT11 and VDAC1. Other substrates include BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1, and AIMP2 (by similarity). It mediates monoubiquitination and various polyubiquitination linkages ('Lys-6', 'Lys-11', 'Lys-48', and 'Lys-63') depending on context. PRKN participates in clearing misfolded proteins via 'Lys-63'-linked polyubiquitination, targeting them for aggresome formation and degradation (by similarity). It positively regulates autophagy by monoubiquitinating BCL2 (by similarity). During cellular stress, PRKN acts downstream of PINK1 to maintain mitochondrial health through mechanisms ranging from preventing apoptosis and promoting mitochondrial biogenesis to mediating mitophagy (by similarity). It ubiquitinates mitochondrial proteins like TOMM20, RHOT1/MIRO1, MFN1, and USP30 to facilitate autophagic clearance of damaged mitochondria (by similarity). PRKN also regulates mitochondrial motility by degrading MIRO1/MIRO2 (by similarity) and promotes mitochondrial biogenesis via 'Lys-48'-linked polyubiquitination and degradation of ZNF746/PARIS (by similarity). Independently of its ligase activity, PRKN suppresses apoptosis by transcriptionally repressing p53/TP53 (by similarity).

Species

Mouse

Source

E. coli

Tag

N-GST

Accession

Q9WVS6-1 (M1-V464)

Gene ID

50873

Protein Length

Full Length of Isoform-1

Synonyms
E3 ubiquitin-protein ligase parkin; Parkin; PARK2; Parkin RBR E3 ubiquitin-protein ligase
AA Sequence

MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV

Predicted Molecular Mass
79.1 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

PRKN Protein, Mouse (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PRKN Protein, Mouse (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PRKN Protein, Mouse (GST)
Cat. No.:
HY-P702810
Quantity:
MCE Japan Authorized Agent: