PRKN Protein, Mouse (GST)

PRKN Protein, Mouse (GST) is the recombinant mouse-derived PRKN, expressed by E. coli , with N-GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

PRKN Protein, Mouse (GST) is the recombinant mouse-derived PRKN, expressed by E. coli , with N-GST labeled tag. ,

Background

PRKN functions as a component of a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin to substrate proteins such as SYT11 and VDAC1. Other substrates include BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1, and AIMP2 (by similarity). It mediates monoubiquitination and various polyubiquitination linkages ('Lys-6', 'Lys-11', 'Lys-48', and 'Lys-63') depending on context. PRKN participates in clearing misfolded proteins via 'Lys-63'-linked polyubiquitination, targeting them for aggresome formation and degradation (by similarity). It positively regulates autophagy by monoubiquitinating BCL2 (by similarity). During cellular stress, PRKN acts downstream of PINK1 to maintain mitochondrial health through mechanisms ranging from preventing apoptosis and promoting mitochondrial biogenesis to mediating mitophagy (by similarity). It ubiquitinates mitochondrial proteins like TOMM20, RHOT1/MIRO1, MFN1, and USP30 to facilitate autophagic clearance of damaged mitochondria (by similarity). PRKN also regulates mitochondrial motility by degrading MIRO1/MIRO2 (by similarity) and promotes mitochondrial biogenesis via 'Lys-48'-linked polyubiquitination and degradation of ZNF746/PARIS (by similarity). Independently of its ligase activity, PRKN suppresses apoptosis by transcriptionally repressing p53/TP53 (by similarity).

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRKN; Parkinson Juvenile Disease Protein 2; Prev. PARK2; Parkinson Protein 2 E3 Ubiquitin Protein Ligase; E3 Ubiquitin-Protein Ligase Parkin; Truncated Parkin Variant SV3,8,9DEL; Parkin; Truncated Parkin Variant SV4,8DEL; AR-JP; Truncated Parkin Variant S

  • AA Sequence

    MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV

  • Predicted Molecular Mass

    79.1 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00