PRKN Protein, Mouse (GST)
PRKN Protein, Mouse (GST) is the recombinant mouse-derived PRKN, expressed by E. coli , with N-GST labeled tag. ,
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
PRKN Protein, Mouse (GST) is the recombinant mouse-derived PRKN, expressed by E. coli , with N-GST labeled tag. ,
Background
PRKN functions as a component of a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin to substrate proteins such as SYT11 and VDAC1. Other substrates include BCL2, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPTIN5, TOMM20, USP30, ZNF746, MIRO1, and AIMP2 (by similarity). It mediates monoubiquitination and various polyubiquitination linkages ('Lys-6', 'Lys-11', 'Lys-48', and 'Lys-63') depending on context. PRKN participates in clearing misfolded proteins via 'Lys-63'-linked polyubiquitination, targeting them for aggresome formation and degradation (by similarity). It positively regulates autophagy by monoubiquitinating BCL2 (by similarity). During cellular stress, PRKN acts downstream of PINK1 to maintain mitochondrial health through mechanisms ranging from preventing apoptosis and promoting mitochondrial biogenesis to mediating mitophagy (by similarity). It ubiquitinates mitochondrial proteins like TOMM20, RHOT1/MIRO1, MFN1, and USP30 to facilitate autophagic clearance of damaged mitochondria (by similarity). PRKN also regulates mitochondrial motility by degrading MIRO1/MIRO2 (by similarity) and promotes mitochondrial biogenesis via 'Lys-48'-linked polyubiquitination and degradation of ZNF746/PARIS (by similarity). Independently of its ligase activity, PRKN suppresses apoptosis by transcriptionally repressing p53/TP53 (by similarity).
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-GST
-
Accession
Q9WVS6-1 (M1-V464)
-
Gene ID50873
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRKN; Parkinson Juvenile Disease Protein 2; Prev. PARK2; Parkinson Protein 2 E3 Ubiquitin Protein Ligase; E3 Ubiquitin-Protein Ligase Parkin; Truncated Parkin Variant SV3,8,9DEL; Parkin; Truncated Parkin Variant SV4,8DEL; AR-JP; Truncated Parkin Variant S
-
AA Sequence
MIVFVRFNSSYGFPVEVDSDTSILQLKEVVAKRQGVPADQLRVIFAGKELPNHLTVQNCDLEQQSIVHIVQRPRRRSHETNASGGDEPQSTSEGSIWESRSLTRVDLSSHTLPVDSVGLAVILDTDSKRDSEAARGPVKPTYNSFFIYCKGPCHKVQPGKLRVQCGTCKQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITSNRRSIPCIACTDVRSPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCGFVFCRDCKEAYHEGDCDSLLEPSGATSQAYRVDKRAAEQARWEEASKETIKKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV
-
Predicted Molecular Mass
79.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)