Copy Link Print Information

PRMT2 Protein, Human (sf9, Flag)

PRMT2 Protein, Human (sf9, Flag) is the recombinant human-derived PRMT2, expressed by Sf9 insect cells , with N-Flag labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • PRMT2 Protein, Human (sf9, Flag) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

PRMT2 Protein, Human (sf9, Flag) is the recombinant human-derived PRMT2, expressed by Sf9 insect cells , with N-Flag labeled tag. ,

Background

PRMT2 is an arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, and histone H4. It acts as a coactivator (with NCOA2) for androgen receptor (AR)-mediated transactivation and (with estrogen) for estrogen receptor (ER)-mediated transactivation. PRMT2 enhances PGR, PPARG, and RARA-mediated transactivation, may inhibit NF-kappa-B transcription, and promotes apoptosis. It represses E2F1 transcriptional activity in an RB1-dependent manner and may be involved in growth regulation.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-Flag
  • Accession

    P55345-1 (A2-R433)

  • Gene ID
    3275
  • Molecular Construction
    • N-term
    • Flag
    • PRMT2 (A2-R433)
      Accession # P55345-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PRMT2; Protein Arginine Methyltransferase 2 Isoform 3; Prev. HRMT1L1; HMT1 HnRNP Methyltransferase-Like 1; Histone-Arginine N-Methyltransferase PRMT2; PRMT2 Alpha; Protein Arginine N-Methyltransferase 2; PRMT2 Gamma; HMT1 (HnRNP Methyltransferase, S. Cere

  • AA Sequence

    ATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

  • Predicted Molecular Mass

    50 kDa

  • Molecular Weight

    Approximately 50-52 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • PRMT2 Protein, Human (sf9, Flag) Product Image
    1/16
  • PRMT2 Protein, Human (sf9, Flag) Product Image