PRMT2 Protein, Human (sf9, GST)
PRMT2 Protein, Human (sf9, GST) is the recombinant human-derived PRMT2, expressed by Sf9 insect cells , with GST labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRMT2 Protein, Human (sf9, GST) is the recombinant human-derived PRMT2, expressed by Sf9 insect cells , with GST labeled tag. ,
Background
PRMT2 is an arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, and histone H4. It acts as a coactivator (with NCOA2) for androgen receptor (AR)-mediated transactivation and (with estrogen) for estrogen receptor (ER)-mediated transactivation. PRMT2 enhances PGR, PPARG, and RARA-mediated transactivation, may inhibit NF-kappa-B transcription, and promotes apoptosis. It represses E2F1 transcriptional activity in an RB1-dependent manner and may be involved in growth regulation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
P55345-1 (M1-R433)
-
Gene ID3275
-
Protein Length
Full Length of Isoform-1
-
Synonyms
PRMT2; Protein Arginine Methyltransferase 2 Isoform 3; Prev. HRMT1L1; HMT1 HnRNP Methyltransferase-Like 1; Histone-Arginine N-Methyltransferase PRMT2; PRMT2 Alpha; Protein Arginine N-Methyltransferase 2; PRMT2 Gamma; HMT1 (HnRNP Methyltransferase, S. Cere
-
AA Sequence
MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR
-
Molecular Weight
Approximately 76 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
