PRND Protein, Human (HEK293, His)
PRND protein is crucial for orchestrating the normal acrosome reaction, ensuring male fertility, and exhibiting copper ion binding capabilities.Its dual functionality highlights its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.PRND Protein, Human (HEK293, His) is the recombinant human-derived PRND protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
PRND protein is crucial for orchestrating the normal acrosome reaction, ensuring male fertility, and exhibiting copper ion binding capabilities.Its dual functionality highlights its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.PRND Protein, Human (HEK293, His) is the recombinant human-derived PRND protein, expressed by HEK293 , with C-6*His labeled tag.
Background
PRND protein is essential for orchestrating the normal acrosome reaction and ensuring regular male fertility. Beyond its critical role in these reproductive processes, PRND exhibits the capability to bind copper ions, as indicated by studies. This dual functionality underscores its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9UKY0 (R27-G152)
-
Molecular Construction
-
N-term
-
PRND (R27-G152)
Accession # Q9UKY0 -
6*His
-
C-term
-
-
Protein Length
Full Length of Prion-like protein doppel Chain
-
Synonyms
PRND; DOPPEL; Prion Like Protein Doppel; Prion Protein 2 (Dublet); PrPLP; Downstream Prion Protein-Like Gene; Prion-Like Protein Doppel; Prion Gene Complex, Downstream; DPL; Downstream Prion Protein-Like; DJ1068H6.4; Prion Protein 2
-
AA Sequence
RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG
-
Predicted Molecular Mass
15.5 kDa
-
Molecular Weight
Approximately 20-29 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
