PRND Protein, Human (HEK293, His)

PRND protein is crucial for orchestrating the normal acrosome reaction, ensuring male fertility, and exhibiting copper ion binding capabilities. Its dual functionality highlights its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions. PRND Protein, Human (HEK293, His) is the recombinant human-derived PRND protein, expressed by HEK293 , with C-6*His labeled tag. The total length of PRND Protein, Human (HEK293, His) is 126 a.a., with molecular weight of 20-29 kDa.

PRND protein is essential for orchestrating the normal acrosome reaction and ensuring regular male fertility. Beyond its critical role in these reproductive processes, PRND exhibits the capability to bind copper ions, as indicated by studies. This dual functionality underscores its significance in the intricate molecular mechanisms governing male reproductive functions and copper ion interactions.

Human

HEK293

C-6*His

Q9UKY0 (R27-G152)

23627  [NCBI]

RGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERG

20-29 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.