PRNP/CD230 Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Although its primary function is unknown, the PRNP/CD230 protein has been implicated in multiple neuronal processes, including neuronal development, synaptic plasticity, and myelin homeostasis. PRNP acts as an agonist of the ADGRG6 receptor and promotes the maintenance of myelin. PRNP/CD230 Protein, Human (HEK293, Fc) is the recombinant human-derived PRNP/CD230 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
PRNP/CD230, while its primary physiological function remains unclear, is implicated in various neuronal processes, including neuronal development and synaptic plasticity. Additionally, it may play a crucial role in maintaining the myelin sheath of neurons and promoting myelin homeostasis by acting as an agonist for the ADGRG6 receptor. The protein's involvement in iron uptake and homeostasis further underscores its multifaceted functions. Soluble oligomers of PRNP exhibit toxicity to neuroblastoma cells, inducing apoptosis in vitro. Association with GPC1, facilitated by heparan sulfate chains, targets PRNP to lipid rafts and contributes to Cu(2+) or Zn(2+) availability for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. PRNP exists both as a monomer and homodimer, with a propensity to aggregate into amyloid fibrils, possibly influenced by copper binding. Notably, PRNP interacts with various proteins, including GRB2, APP, ERI3/PRNPIP, SYN1, and ADGRG6, suggesting a complex network of molecular interactions.
Verified Bioactivity
Measured by its ability to inhibit proliferation of SH-SY5Y cells. The ED50 for this effect is 0.135 μg/mL, corresponding to a specific activity is 7.358×103 units/mg.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
P04156 (K23-G229)
-
Gene ID5621
-
Molecular Construction
-
N-term
-
PRNP (K23-G229)
Accession # P04156/NP_000302.1 -
hFc
-
C-term
-
-
Protein Length
Full Length of Interaction with GRB2, ERI3 and SYN1 Region
-
Synonyms
PRNP; PrP27-30; Prev. PRIP; ASCR; Prev. CJD; Gerstmann-Strausler-Scheinker Syndrome; Prev. GSS; Creutzfeldt-Jakob Disease; AltPrP; Fatal Familial Insomnia; PRP; Prion Protein (P27-30); Alternative Prion Protein; Prion-Related Protein; Major Prion Protein;
-
AA Sequence
KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG
-
Predicted Molecular Mass
48.7 kDa
-
Molecular Weight
Approximately 58-70 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
