Pro-COL1A1 Protein, Human (HEK293, His)

The procollagen alpha 1/COL1A1 protein is an important type I collagen component and forms a trimeric structure with alpha 2(I) and two alpha 1(I) chains. It interacts with MRC2, associates with MFAP4 in a Ca2+-dependent manner, and interacts with TRAM2. Pro-COL1A1 Protein, Human (HEK293, His) is the recombinant human-derived Pro-COL1A1 protein, expressed by HEK293, with N-His labeled tag.

Pro-Collagen I alpha 1/COL1A1 Protein, a crucial component of type I collagen, is a member of the fibrillar-forming collagen group I. It forms trimeric structures consisting of one alpha 2(I) and two alpha 1(I) chains. The protein interacts with MRC2 and, in a calcium (Ca2+)-dependent manner, associates with MFAP4. Additionally, Pro-Collagen I alpha 1/COL1A1 Protein interacts with TRAM2, as reported in scientific literature. These interactions underline the protein's role in the assembly and structural integrity of type I collagen, contributing to its fundamental function in providing strength and support to various tissues in the body.

Human

HEK293

N-His

P02452 (Q23-P161)

1277

Propeptide

QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP

Approximately 23-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.