Pro-COL1A1 Protein, Human (HEK293, His)
The procollagen alpha 1/COL1A1 protein is an important type I collagen component and forms a trimeric structure with alpha 2(I) and two alpha 1(I) chains. It interacts with MRC2, associates with MFAP4 in a Ca2+-dependent manner, and interacts with TRAM2. Pro-COL1A1 Protein, Human (HEK293, His) is the recombinant human-derived Pro-COL1A1 protein, expressed by HEK293, with N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The procollagen alpha 1/COL1A1 protein is an important type I collagen component and forms a trimeric structure with alpha 2(I) and two alpha 1(I) chains. It interacts with MRC2, associates with MFAP4 in a Ca2+-dependent manner, and interacts with TRAM2. Pro-COL1A1 Protein, Human (HEK293, His) is the recombinant human-derived Pro-COL1A1 protein, expressed by HEK293, with N-His labeled tag.
Background
Pro-Collagen I alpha 1/COL1A1 Protein, a crucial component of type I collagen, is a member of the fibrillar-forming collagen group I. It forms trimeric structures consisting of one alpha 2(I) and two alpha 1(I) chains. The protein interacts with MRC2 and, in a calcium (Ca2+)-dependent manner, associates with MFAP4. Additionally, Pro-Collagen I alpha 1/COL1A1 Protein interacts with TRAM2, as reported in scientific literature. These interactions underline the protein's role in the assembly and structural integrity of type I collagen, contributing to its fundamental function in providing strength and support to various tissues in the body.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-His
-
Accession
P02452 (Q23-P161)
-
Gene ID1277
-
Molecular Construction
-
N-term
-
His
-
COL1A1 (Q23-P161)
Accession # P02452 -
C-term
-
-
Protein Length
Propeptide
-
Synonyms
COL1A1; Collagen Alpha 1(I) Chain; Collagen Type I Alpha 1 Chain; Collagen Type I Alpha 1; OI4; Collagen Col1-ColIII-1; Collagen Alpha-1(I) Chain Preproprotein; Collagen Col1-ColIII-2; Type I Procollagen Alpha 1 Chain; Alpha1(I) Procollagen; Collagen, Typ
-
AA Sequence
QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAP
-
Predicted Molecular Mass
16.7 kDa
-
Molecular Weight
Approximately 23-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
