Progranulin/PGRN Protein, Human (HEK293, His, solution)

Progranulin (PGRN, encoded by the GRN gene) plays a key role in the development, survival, function, and maintenance of neurons and microglia in the mammalian brain. It regulates lysosomal biogenesis, inflammation, repair, stress response, and aging. Progranulin/PGRN Protein, Human (HEK293, His, solution) is the recombinant human-derived Progranulin/PGRN protein, expressed by HEK293 , with C-10*His labeled tag.

The Progranulin/PGRN Protein represents an 88 kDa precursor protein, also known as proepithelin and PC cell-derived growth factor, from which a family of secreted, glycosylated peptides called granulins is cleaved. This cleavage yields mature granulins, further processed into active 6 kDa peptides, including granulin A, granulin B, granulin C, and so forth. Epithelins 1 and 2 are synonymous with granulins A and B, respectively. The granulin family, with its 7.5 repeats of a highly conserved 12-cysteine granulin/epithelin motif, plays a crucial role in regulating cell growth, with various members acting as inhibitors, stimulators, or having dual actions on cell growth. Ubiquitously expressed, Progranulin/PGRN exhibits elevated levels in the bone marrow (RPKM 141.7), lung (RPKM 139.8), and 25 other tissues, emphasizing its potential significance in diverse physiological processes across multiple organs.

Human

HEK293

C-10*His

NP_002078.1 (T18-L593)

2896  [NCBI]

Full Length of Mature Protein

TRCPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAVALSSSVMCPDARSRCPDGSTCCELPSGKYGCCPMPNATCCSDHLHCCPQDTVCDLIQSKCLSKENATTDLLTKLPAHTVGDVKCDMEVSCPDGYTCCRLQSGAWGCCPFTQAVCCEDHIHCCPAGFTCDTQKGTCEQGPHQVPWMEKAPAHLSLPDPQALKRDVPCDNVSSCPSSDTCCQLTSGEWGCCPIPEAVCCSDHQHCCPQGYTCVAEGQCQRGSEIVAGLEKMPARRASLSHPRDIGCDQHTSCPVGQTCCPSLGGSWACCQLPHAVCCEDRQHCCPAGYTCNVKARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGTKCLRREAPRWDAPLRDPALRQLL

Approximately 93 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.