Prok2 Protein, Mouse (His-B2M)
Prok2 Protein, Mouse (His-B2M) is the recombinant mouse-derived Prok2 protein, expressed by E. coli, with N-B2M & N-6*His tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Prok2 Protein, Mouse (His-B2M) is the recombinant mouse-derived Prok2 protein, expressed by E. coli, with N-B2M & N-6*His tag.
Background
Prok2 may function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. It could also act locally within the SCN to synchronize output. Additionally, Prok2 potently contracts gastrointestinal (GI) smooth muscle (by similarity).
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-B2M;N-6*His
-
Accession
Q9QXU7 (A27-K128)
-
Gene ID50501
-
Molecular Construction
-
N-term
-
6*His-B2M
-
Prok2 (A27-K128)
Accession # Q9QXU7 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PROK2; MIT1; Prokineticin 2; KAL4; PK2; Prokineticin-2; BV8; HH4; Protein Bv8 Homolog
-
AA Sequence
AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGQVGDSCHPLTRKSHVANGRQERRRAKRRKRKKEVPFWGRRMHHTCPCLPGLACLRTSFNRFICLARK
-
Predicted Molecular Mass
24.02 kDa
-
Molecular Weight
Approximately 26 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
